(data stored in ACNUC6288 zone)

EMBL: CR382138.PE414

CR382138.PE414       Location/Qualifiers
FT   CDS             823183..824382
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09570g"
FT                   /old_locus_tag="DEHA0F10483g"
FT                   /old_locus_tag="DEHA-IPF8304"
FT                   /old_locus_tag="DEHA-CDS3195.1"
FT                   /product="DEHA2F09570p"
FT                   /note="similar to uniprot|P06168 Saccharomyces cerevisiae
FT                   YLR355C ILV5 Acetohydroxyacid reductoisomerase
FT                   mitochondrial protein involved in branched-chain amino acid
FT                   biosynthesis also required for maintenance of wild- type
FT                   mitochondrial DNA"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09570g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89118"
FT                   /db_xref="GOA:Q6BLZ4"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016207"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLZ4"
FT                   /protein_id="CAG89118.1"
FT                   /translation="MSIRNASIRMARMASNNAAKQVASKRALSALANAARPVVARKSIA
FT                   PAAARGVKTINFGGMDEIVHERADWPREKLLEYFKNDTLALIGYGSQGYGQGLNLRDNG
FT                   LNVIIGVRKDGASWKAAIEDGWVPGENLFDVNEAIGKGTYIMNLLSDAAQSETWESIKP
FT                   QLTEGKTLYFSHGFSPVFKELTHVEPPTNIDVILAAPKGSGRTVRTLFKEGRGINSSYA
FT                   VWNDVTGKAEEKAIALAVAIGSGYVYQTTFEREVNSDLYGERGCLMGGIHGMFLAQYEV
FT                   LRENGHTPSEAFNETVEEATQSLYPLIGKYGMDYMYDACSTTARRGALDWYPRFKDALK
FT                   PVFNDLYESVKNGTETQRSLDFNSQSDYRARLEEELETIRSMEIWRVGKEVRKLRPENQ
FT                   "
     MSIRNASIRM ARMASNNAAK QVASKRALSA LANAARPVVA RKSIAPAAAR GVKTINFGGM        60
     DEIVHERADW PREKLLEYFK NDTLALIGYG SQGYGQGLNL RDNGLNVIIG VRKDGASWKA       120
     AIEDGWVPGE NLFDVNEAIG KGTYIMNLLS DAAQSETWES IKPQLTEGKT LYFSHGFSPV       180
     FKELTHVEPP TNIDVILAAP KGSGRTVRTL FKEGRGINSS YAVWNDVTGK AEEKAIALAV       240
     AIGSGYVYQT TFEREVNSDL YGERGCLMGG IHGMFLAQYE VLRENGHTPS EAFNETVEEA       300
     TQSLYPLIGK YGMDYMYDAC STTARRGALD WYPRFKDALK PVFNDLYESV KNGTETQRSL       360
     DFNSQSDYRA RLEEELETIR SMEIWRVGKE VRKLRPENQ                              399
//

If you have problems or comments...

PBIL Back to PBIL home page