(data stored in ACNUC6288 zone)

EMBL: CR382138.PE416

CR382138.PE416       Location/Qualifiers
FT   CDS             828016..828786
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09614g"
FT                   /old_locus_tag="DEHA0F10527g"
FT                   /old_locus_tag="DEHA-IPF8302"
FT                   /old_locus_tag="DEHA-CDS4730.1"
FT                   /product="DEHA2F09614p"
FT                   /note="highly similar to uniprot|P23248 Saccharomyces
FT                   cerevisiae YML063W RPS1B Ribosomal protein 10 (rp10) of the
FT                   small (40S) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09614g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89120"
FT                   /db_xref="GOA:Q6BLZ2"
FT                   /db_xref="InterPro:IPR001593"
FT                   /db_xref="InterPro:IPR018281"
FT                   /db_xref="InterPro:IPR027500"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BLZ2"
FT                   /protein_id="CAG89120.1"
FT                   /translation="MAVGKNKRLSKGKKGLKKKVVDPFTKKEWFDIKAPSTFENRAVGK
FT                   TLINRSTGLKNAADGLKGRVVEVCLADLQGSEDHSSRKVKLRVDEVQGKNLLTNFHGID
FT                   FTTDKLRSLVRKWQSLVEANVTVKTSDDYVLRIFAIAFTKRQANQIRKTTYAQSSKLRE
FT                   VRKKMIEIMQREVSNCTLAQLTSKLIPEVIGREIEKSTQTILPLQNIHIRKVKLLKQPK
FT                   FDLGSLLALHGEGSTEEKGKKVSAGFKDVVLEAV"
     MAVGKNKRLS KGKKGLKKKV VDPFTKKEWF DIKAPSTFEN RAVGKTLINR STGLKNAADG        60
     LKGRVVEVCL ADLQGSEDHS SRKVKLRVDE VQGKNLLTNF HGIDFTTDKL RSLVRKWQSL       120
     VEANVTVKTS DDYVLRIFAI AFTKRQANQI RKTTYAQSSK LREVRKKMIE IMQREVSNCT       180
     LAQLTSKLIP EVIGREIEKS TQTILPLQNI HIRKVKLLKQ PKFDLGSLLA LHGEGSTEEK       240
     GKKVSAGFKD VVLEAV                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page