(data stored in ACNUC6288 zone)

EMBL: CR382138.PE426

CR382138.PE426       Location/Qualifiers
FT   CDS             844784..845386
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09834g"
FT                   /old_locus_tag="DEHA0F10758g"
FT                   /old_locus_tag="DEHA-IPF8285"
FT                   /old_locus_tag="DEHA-CDS5362.1"
FT                   /product="DEHA2F09834p"
FT                   /note="similar to uniprot|Q08746 Saccharomyces cerevisiae
FT                   YOR294W RRS1 Essential protein that binds ribosomal protein
FT                   L11 and is required for nuclear export of the 60S
FT                   pre-ribosomal subunit during ribosome biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09834g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89131"
FT                   /db_xref="GOA:Q6BLY1"
FT                   /db_xref="InterPro:IPR007023"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLY1"
FT                   /protein_id="CAG89131.1"
FT                   /translation="MSEQQFKPVTVDKPIPNTYDLGNLATFDPNPLDNDKLKDESQKEE
FT                   YLTSVTRDNVQLLINQILSLPVKTTTDSQGSSTGQNSTMTLIQLPDPTTQLPREKAIPK
FT                   TKAPTKWEQFAARKGIKAKAKDGKMVFDEATGEWVPKWGYKGKNKELDDQWLVEVDDKV
FT                   KGTEDELIDPRTLNRAERKRLVKKNELQHKRNLKNQS"
     MSEQQFKPVT VDKPIPNTYD LGNLATFDPN PLDNDKLKDE SQKEEYLTSV TRDNVQLLIN        60
     QILSLPVKTT TDSQGSSTGQ NSTMTLIQLP DPTTQLPREK AIPKTKAPTK WEQFAARKGI       120
     KAKAKDGKMV FDEATGEWVP KWGYKGKNKE LDDQWLVEVD DKVKGTEDEL IDPRTLNRAE       180
     RKRLVKKNEL QHKRNLKNQS                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page