(data stored in ACNUC6288 zone)

EMBL: CR382138.PE43

CR382138.PE43        Location/Qualifiers
FT   CDS             complement(98790..99815)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01100g"
FT                   /old_locus_tag="DEHA0F01309g"
FT                   /old_locus_tag="DEHA-IPF9017"
FT                   /old_locus_tag="DEHA-CDS3912.1"
FT                   /product="DEHA2F01100p"
FT                   /note="highly similar to uniprot|P09201 Saccharomyces
FT                   cerevisiae YLR377C FBP1 Fructose-1 6-bisphosphatase key
FT                   regulatory enzyme in the gluconeogenesis pathway required
FT                   for glucose metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01100g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88714"
FT                   /db_xref="GOA:Q6BN10"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR020548"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN10"
FT                   /protein_id="CAG88714.2"
FT                   /translation="MSTQHNSVSEQMNVDTDIITLTRFILQEQQKEAPNATGELSLLLN
FT                   SLQFAFKFIAHNIRRAELVNLIGISGSANSTGDVQKKLDVIGDEIFINAMKSSNNVKVL
FT                   VSEEQEDLIVFEGGGRYAVCTDPIDGSSNIDAGVSVGTIFGIYRLKEDSQGSIKDVLRK
FT                   GTEMVAAGYTMYGASAHLMLTTGQGVNGFTLDTQLGEFILTQPHLTIPKTRAIYSVNEG
FT                   NSHYWADSAKQYIADLKKPQEDGKPYSARYIGSMVADIHRTILYGGIFAYPADSKSKNG
FT                   KLRILYECFPMAMLMEQAGGAAINDKGERILEILPKGIHDKSGIWLGSTGEVDRYLTYL
FT                   K"
     MSTQHNSVSE QMNVDTDIIT LTRFILQEQQ KEAPNATGEL SLLLNSLQFA FKFIAHNIRR        60
     AELVNLIGIS GSANSTGDVQ KKLDVIGDEI FINAMKSSNN VKVLVSEEQE DLIVFEGGGR       120
     YAVCTDPIDG SSNIDAGVSV GTIFGIYRLK EDSQGSIKDV LRKGTEMVAA GYTMYGASAH       180
     LMLTTGQGVN GFTLDTQLGE FILTQPHLTI PKTRAIYSVN EGNSHYWADS AKQYIADLKK       240
     PQEDGKPYSA RYIGSMVADI HRTILYGGIF AYPADSKSKN GKLRILYECF PMAMLMEQAG       300
     GAAINDKGER ILEILPKGIH DKSGIWLGST GEVDRYLTYL K                           341
//

If you have problems or comments...

PBIL Back to PBIL home page