(data stored in ACNUC6288 zone)

EMBL: CR382138.PE431

CR382138.PE431       Location/Qualifiers
FT   CDS             join(858158..858210,858292..858607)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09944g"
FT                   /product="DEHA2F09944p"
FT                   /note="similar to uniprot|P38902 Saccharomyces cerevisiae
FT                   YOL005C RPB11 RNA polymerase II subunit B12.5"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09944g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89138"
FT                   /db_xref="GOA:Q6BLX4"
FT                   /db_xref="InterPro:IPR008193"
FT                   /db_xref="InterPro:IPR009025"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR037685"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLX4"
FT                   /protein_id="CAG89138.1"
FT                   /translation="MNAPDRFELFILPDGVDKIKITPDTKVPNAALIKIEREDHTLGNL
FT                   IRAQLLKDERVLFAAYKVEHPLFANFVLRIQTEDDYSPREALRNACSGLIGELDVIKTR
FT                   FKDEWALKSLLNSNDDDF"
     MNAPDRFELF ILPDGVDKIK ITPDTKVPNA ALIKIEREDH TLGNLIRAQL LKDERVLFAA        60
     YKVEHPLFAN FVLRIQTEDD YSPREALRNA CSGLIGELDV IKTRFKDEWA LKSLLNSNDD       120
     DF                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page