(data stored in ACNUC6288 zone)

EMBL: CR382138.PE439

CR382138.PE439       Location/Qualifiers
FT   CDS             complement(871604..873052)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10120g"
FT                   /old_locus_tag="DEHA0F11077g"
FT                   /old_locus_tag="DEHA-IPF8260"
FT                   /old_locus_tag="DEHA-CDS2466.1"
FT                   /product="DEHA2F10120p"
FT                   /note="highly similar to uniprot|Q9UUU1 Yarrowia lipolytica
FT                   YALI0F17248g nucm NUCM protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10120g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89146"
FT                   /db_xref="GOA:Q6BLW6"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLW6"
FT                   /protein_id="CAG89146.1"
FT                   /translation="MLRVKNISNSVRLASRARHGSLSSRAFSNFSRLNAAVNDESNVKP
FT                   FKHALGRDAQRYSDEPGTFGKTTFTESMDEVDMTWGRDDDPKHVEKQNTKIRHFTINFG
FT                   PQHPAAHGVLRLILELHGEEIVRADPHVGLLHRGTEKLIESKTYMQAIPYFDRLDYVSM
FT                   MTNELVFALAVEKLLNIEVPLRAKYIRTLFGEITRILNHCMSVLSHIMDVGGLTPFLWG
FT                   FEEREKLMEFYERVSGARLHSNYVRPGGVSQDMPVGLLDDIYMWATQFGDRIDETEELI
FT                   TDNRIWAARTKDVGVVTAEDALNYSLSGVMLRGSGIPYDIRKAQPYDAYELVDFDVAVG
FT                   MNGDCYDRYLIRMAEFRQSLRIIYQCINDMPNGPIKTEDFKVSAPPRSMMKEDMEALIH
FT                   HFLLYTKGYAVPQGETYTAIEAPKGEMAVYVVSDGSERPYRCKIRAPGFAHLGAFDHIS
FT                   RGNLLADAVAIIGTMDLVFGEVDR"
     MLRVKNISNS VRLASRARHG SLSSRAFSNF SRLNAAVNDE SNVKPFKHAL GRDAQRYSDE        60
     PGTFGKTTFT ESMDEVDMTW GRDDDPKHVE KQNTKIRHFT INFGPQHPAA HGVLRLILEL       120
     HGEEIVRADP HVGLLHRGTE KLIESKTYMQ AIPYFDRLDY VSMMTNELVF ALAVEKLLNI       180
     EVPLRAKYIR TLFGEITRIL NHCMSVLSHI MDVGGLTPFL WGFEEREKLM EFYERVSGAR       240
     LHSNYVRPGG VSQDMPVGLL DDIYMWATQF GDRIDETEEL ITDNRIWAAR TKDVGVVTAE       300
     DALNYSLSGV MLRGSGIPYD IRKAQPYDAY ELVDFDVAVG MNGDCYDRYL IRMAEFRQSL       360
     RIIYQCINDM PNGPIKTEDF KVSAPPRSMM KEDMEALIHH FLLYTKGYAV PQGETYTAIE       420
     APKGEMAVYV VSDGSERPYR CKIRAPGFAH LGAFDHISRG NLLADAVAII GTMDLVFGEV       480
     DR                                                                      482
//

If you have problems or comments...

PBIL Back to PBIL home page