(data stored in ACNUC6288 zone)

EMBL: CR382138.PE444

CR382138.PE444       Location/Qualifiers
FT   CDS             complement(880906..881562)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10252g"
FT                   /old_locus_tag="DEHA0F11209g"
FT                   /old_locus_tag="DEHA-IPF8251"
FT                   /old_locus_tag="DEHA-CDS5176.1"
FT                   /product="DEHA2F10252p"
FT                   /note="similar to uniprot|P00572 Saccharomyces cerevisiae
FT                   YJR057W CDC8 Thymidylate and uridylate kinase functions in
FT                   de novo biosynthesis of pyrimidine deoxyribonucleotides"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10252g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89151"
FT                   /db_xref="GOA:Q6BLW1"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLW1"
FT                   /protein_id="CAG89151.2"
FT                   /translation="MGRGQLILIEGLDRSGKSTQSGILSERLPGGKLIKFPDRSTKVGS
FT                   IINEYLTNSELNLSDQTAHLLFSANRWELADSIVNDLNKGHFIVMDRYIYSGIAYSLAK
FT                   SRFSNDSSPEMASIDWLYSPDKGLPKPDLTIFLTLSLEELSNRKGWGEERYEKENFQKS
FT                   VKNCFLEVLNADNDASVHIIDVNNLNIDQVTAKIWDLIEQKNLNKQTENSIERFT"
     MGRGQLILIE GLDRSGKSTQ SGILSERLPG GKLIKFPDRS TKVGSIINEY LTNSELNLSD        60
     QTAHLLFSAN RWELADSIVN DLNKGHFIVM DRYIYSGIAY SLAKSRFSND SSPEMASIDW       120
     LYSPDKGLPK PDLTIFLTLS LEELSNRKGW GEERYEKENF QKSVKNCFLE VLNADNDASV       180
     HIIDVNNLNI DQVTAKIWDL IEQKNLNKQT ENSIERFT                               218
//

If you have problems or comments...

PBIL Back to PBIL home page