(data stored in ACNUC6288 zone)

EMBL: CR382138.PE445

CR382138.PE445       Location/Qualifiers
FT   CDS             join(882909..882933,883057..885944)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10274g"
FT                   /old_locus_tag="DEHA0F11231g"
FT                   /product="DEHA2F10274p"
FT                   /note="similar to Candida albicans Q59TV6 Hypothetical
FT                   protein SVL3"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10274g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89152"
FT                   /db_xref="GOA:Q6BLW0"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLW0"
FT                   /protein_id="CAG89152.2"
FT                   /translation="MSSIEILTVGSNPNVAFYAWRLHETQSCNVSVVNSRIKGDSINWR
FT                   SPVLGTSTFKPYEIYQDLSQISPGSNKYDIVFISCTSLQDFQTVCADLVPFLHKKSAIV
FT                   VESTGYVNLEPFVQLSFPSMKDITICCIMNESDVRQIDGDNFTHILRNNDNRIYLGTSL
FT                   TNSNISSTSNPSFQKVYKLMQLVQQDSSNSISLLKSIVPKEFMTYQWKLALPRIVFNPL
FT                   SVIFEAEVPANLSNQILCKPLITGMINEIFKIIKKMDCKLVKGSENENNLFKNWCSSFP
FT                   EAPKNQNYLNSPPLFYEFYRQYDLNIDLLLLQPILLADDHGIRTPYLENIYSTMCQYIK
FT                   INDADTNSIFFTRKSNSNMNKGKVNQINADHEFKLNQLNIISSDLARMESNKNQLDSYL
FT                   REKEILKGQVGEDINKQELNLRKLNINVDHQQQKLSQIEQRLEQLQLQEQKIGNNQMKS
FT                   IQPSELEERTLPQSETNRTFRDSVAPNDNLEDLADIALYGAALGSPVPNQNASHNGEAD
FT                   MNGSSVPNRALNMNGGNDQVHSNGNAHSNGNIQLLNGDLPQHLHEKELELQKRERVLIN
FT                   RELSLPNDNQMNGYYDNEQHRQPQHPQQQPHQQTPPALHLDTQQKNMNMPPNQQQYYNQ
FT                   RQYNNNHGYMPSPMDQQLPHGLPSNGLPPNALPPNLRVNSMNSNMNRYNMPPPQMVNGN
FT                   PHQANGYGGKTQRLSSFPSSSHNYQDLHQQQYMQNPPQQQYYNNTYQNGPPVDPGVESR
FT                   FKAQPRKSNRRSAFPQMNGDLSGLDMGGRGGMPMPGGTNPAATKANKHRSAMPMNANGN
FT                   RTSPPQHKKSASNYAIPQGQGQGQGQGQGQGQGQGQGQAQAQAQAQAQAQAQGHAQGHA
FT                   QAQGTRINVLGQGQPSSEPQQYNHAQPQQQYLQLPNGSNASSNSSNSVNTNDTPQTNDE
FT                   GVQIHVPIADPNTNAKPLGGISNPNKEVETKKKRGLFRKH"
     MSSIEILTVG SNPNVAFYAW RLHETQSCNV SVVNSRIKGD SINWRSPVLG TSTFKPYEIY        60
     QDLSQISPGS NKYDIVFISC TSLQDFQTVC ADLVPFLHKK SAIVVESTGY VNLEPFVQLS       120
     FPSMKDITIC CIMNESDVRQ IDGDNFTHIL RNNDNRIYLG TSLTNSNISS TSNPSFQKVY       180
     KLMQLVQQDS SNSISLLKSI VPKEFMTYQW KLALPRIVFN PLSVIFEAEV PANLSNQILC       240
     KPLITGMINE IFKIIKKMDC KLVKGSENEN NLFKNWCSSF PEAPKNQNYL NSPPLFYEFY       300
     RQYDLNIDLL LLQPILLADD HGIRTPYLEN IYSTMCQYIK INDADTNSIF FTRKSNSNMN       360
     KGKVNQINAD HEFKLNQLNI ISSDLARMES NKNQLDSYLR EKEILKGQVG EDINKQELNL       420
     RKLNINVDHQ QQKLSQIEQR LEQLQLQEQK IGNNQMKSIQ PSELEERTLP QSETNRTFRD       480
     SVAPNDNLED LADIALYGAA LGSPVPNQNA SHNGEADMNG SSVPNRALNM NGGNDQVHSN       540
     GNAHSNGNIQ LLNGDLPQHL HEKELELQKR ERVLINRELS LPNDNQMNGY YDNEQHRQPQ       600
     HPQQQPHQQT PPALHLDTQQ KNMNMPPNQQ QYYNQRQYNN NHGYMPSPMD QQLPHGLPSN       660
     GLPPNALPPN LRVNSMNSNM NRYNMPPPQM VNGNPHQANG YGGKTQRLSS FPSSSHNYQD       720
     LHQQQYMQNP PQQQYYNNTY QNGPPVDPGV ESRFKAQPRK SNRRSAFPQM NGDLSGLDMG       780
     GRGGMPMPGG TNPAATKANK HRSAMPMNAN GNRTSPPQHK KSASNYAIPQ GQGQGQGQGQ       840
     GQGQGQGQGQ AQAQAQAQAQ AQAQGHAQGH AQAQGTRINV LGQGQPSSEP QQYNHAQPQQ       900
     QYLQLPNGSN ASSNSSNSVN TNDTPQTNDE GVQIHVPIAD PNTNAKPLGG ISNPNKEVET       960
     KKKRGLFRKH                                                              970
//

If you have problems or comments...

PBIL Back to PBIL home page