(data stored in ACNUC6288 zone)

EMBL: CR382138.PE45

CR382138.PE45        Location/Qualifiers
FT   CDS             100920..102359
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01144g"
FT                   /old_locus_tag="DEHA0F01353g"
FT                   /old_locus_tag="DEHA-IPF9013"
FT                   /old_locus_tag="DEHA-CDS2489.1"
FT                   /product="DEHA2F01144p"
FT                   /note="highly similar to uniprot|P32915 Saccharomyces
FT                   cerevisiae YLR378C SEC61 Essential subunit of Sec61 complex
FT                   (Sec61p Sbh1p and Sss1p)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01144g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88716"
FT                   /db_xref="GOA:Q6BN08"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR019561"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BN08"
FT                   /protein_id="CAG88716.1"
FT                   /translation="MSGFRVLDLVKPFTPFMPEVIAPERKVAFQQRLMWTGVTLLIFLV
FT                   MSEIPLYGIASSDGSDPLYWLRMMLASNRGTLMELGISPIVSAGMVFQLLQGTKLITVD
FT                   MSNKNDRDQFQTAQKLFAILLAVGQATVYVLTGMYGPPSSLGTGVCLLLVLQLVFAGIV
FT                   VILLDELLQKGYGLGSGISLFTATNVCEQVFWKAFAPTTSNIGKGTEFEGAVVALFHLL
FT                   GSRKDKKRALLEAFYRSHLPNMFQLIATVFVFLLVVYLQGFRIELPIKSTRQRGPYGLY
FT                   PIRLFYTSNIPIMLQSALSSNIFIISQMLFVRWPNNIFVKILGSWDTRQGAAQLYAVSG
FT                   LAYYIQPPLSFTEALLDPIKTIIYIIFVLGSCAVFSTTWIEISGASPRDVAKQFKEQGL
FT                   VIAGHRDTSAYRELKKIIPTAAAFGGATIGALSVFCDLMGTLGSGTSILLSVTTIYGYY
FT                   ELAMKEGGFGKSVVSSFSDGI"
     MSGFRVLDLV KPFTPFMPEV IAPERKVAFQ QRLMWTGVTL LIFLVMSEIP LYGIASSDGS        60
     DPLYWLRMML ASNRGTLMEL GISPIVSAGM VFQLLQGTKL ITVDMSNKND RDQFQTAQKL       120
     FAILLAVGQA TVYVLTGMYG PPSSLGTGVC LLLVLQLVFA GIVVILLDEL LQKGYGLGSG       180
     ISLFTATNVC EQVFWKAFAP TTSNIGKGTE FEGAVVALFH LLGSRKDKKR ALLEAFYRSH       240
     LPNMFQLIAT VFVFLLVVYL QGFRIELPIK STRQRGPYGL YPIRLFYTSN IPIMLQSALS       300
     SNIFIISQML FVRWPNNIFV KILGSWDTRQ GAAQLYAVSG LAYYIQPPLS FTEALLDPIK       360
     TIIYIIFVLG SCAVFSTTWI EISGASPRDV AKQFKEQGLV IAGHRDTSAY RELKKIIPTA       420
     AAFGGATIGA LSVFCDLMGT LGSGTSILLS VTTIYGYYEL AMKEGGFGKS VVSSFSDGI        479
//

If you have problems or comments...

PBIL Back to PBIL home page