(data stored in ACNUC6288 zone)

EMBL: CR382138.PE455

CR382138.PE455       Location/Qualifiers
FT   CDS             complement(902448..902912)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10494g"
FT                   /old_locus_tag="DEHA0F11462g"
FT                   /old_locus_tag="DEHA-IPF8225"
FT                   /old_locus_tag="DEHA-CDS6000.1"
FT                   /product="DEHA2F10494p"
FT                   /note="similar to uniprot|Q02642 Saccharomyces cerevisiae
FT                   YPL037C EGD1 Subunit beta1 of the nascent polypeptide-
FT                   associated complex (NAC) involved in protein targeting
FT                   associated with cytoplasmic ribosomes"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10494g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89163"
FT                   /db_xref="GOA:Q6BLV1"
FT                   /db_xref="InterPro:IPR002715"
FT                   /db_xref="InterPro:IPR038187"
FT                   /db_xref="InterPro:IPR039370"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BLV1"
FT                   /protein_id="CAG89163.1"
FT                   /translation="MPVDPEKLAKLQKASVAKKVGGSRVKAKKNVKTEQDDTKLIEALG
FT                   KLKAQKIEGIEEANFFKEDGKVLHFNRVGVQGAAQHNTFALTGYPQEKDVTQLIPQILP
FT                   QLGAENLEILRKLAEQIQAGKNPELNAGGAEGAEEDIPDLIEGQKFDDVE"
     MPVDPEKLAK LQKASVAKKV GGSRVKAKKN VKTEQDDTKL IEALGKLKAQ KIEGIEEANF        60
     FKEDGKVLHF NRVGVQGAAQ HNTFALTGYP QEKDVTQLIP QILPQLGAEN LEILRKLAEQ       120
     IQAGKNPELN AGGAEGAEED IPDLIEGQKF DDVE                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page