(data stored in ACNUC6288 zone)

EMBL: CR382138.PE46

CR382138.PE46        Location/Qualifiers
FT   CDS             103410..105980
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01166g"
FT                   /old_locus_tag="DEHA0F01375g"
FT                   /old_locus_tag="DEHA-IPF9010"
FT                   /old_locus_tag="DEHA-CDS0690.1"
FT                   /product="DEHA2F01166p"
FT                   /note="weakly similar to uniprot|Q76I27 Pichia pastoris
FT                   PNO1 PNO1 protein and similar to CA4175|IPF4425.repeat2
FT                   Candida albicans IPF4425.repeat2 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01166g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88717"
FT                   /db_xref="GOA:Q6BN07"
FT                   /db_xref="InterPro:IPR007074"
FT                   /db_xref="InterPro:IPR009644"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN07"
FT                   /protein_id="CAG88717.2"
FT                   /translation="MPQPISGSNIGIGAKSRTLFRKVGNAKTIKFIIVLIAIVNILYIS
FT                   TLLVDERTSSTLTSKIKNHASYVLDNFYESDEEEAEDGTVFTDIPEANTVYSNNQNGQG
FT                   SESIHKYDKTLYNIPNRPYDQLSTSDKILFKLNEITSDSEKYWLGHTELTDYELEIQVD
FT                   DFVKSAWKEKQTIFYDPRFTLAIYINEIKNQYLKKNPDNEKHKSHEIVVPFAWSDWVDL
FT                   TMLNEELSKPESQRKNCEYMKATHHIPAKDADYCINNVAITNADLKEMNLPSTKFVPGF
FT                   AVKKSPTNKASNEVRMLEGKSHLLTYAPNPLAIIFLTNDGVYEAQIEGKQRIVDSNLFE
FT                   DFLTSTKNKDPKIIMNPVKEFNDLLARVKPNPLDPEDDEFGMVAKIKDKNPEKTKEVYL
FT                   PQKAFNYQQDKIDVQLEEYETKMKTLHDLTTNELIFDHHTINKLKLTRNEKIYYEGLKY
FT                   ANKFELAKEPTYFRMARLNFQTEENDHDAGWHYEWRFFNGALRYLKKGWNEEELLIREK
FT                   VLLDRILRNWFKFANEKGIISWIAHGPLLSWYWDGLLFPFDEDIDIQMPAEELTRFSKL
FT                   YNQTLVVEDISEGFGKYFIDCSTFIHHRGKSYKENHIDARFIDIDTGSYIDITGLGISK
FT                   EEAPDKYKDIVNQAAIFNQPKPVYNCRNLHFYSYDEISPLRYTMIGGVPCYIPNKVEDI
FT                   LKDEYTKGMSVYDFEGFYFIDPLNLWIHQQKLKFLFDQSHAHLFNDKEEVTNREEFTNL
FT                   VKGMNEEQILSLLEHNEDILLEYYLTKDVTDLHKQELTYMFNMPDGENTKIGNINGQKQ
FT                   QSEISENLEYHKLTSRFKFQKPFRRPLFNYEKIDKPKHAKPSTA"
     MPQPISGSNI GIGAKSRTLF RKVGNAKTIK FIIVLIAIVN ILYISTLLVD ERTSSTLTSK        60
     IKNHASYVLD NFYESDEEEA EDGTVFTDIP EANTVYSNNQ NGQGSESIHK YDKTLYNIPN       120
     RPYDQLSTSD KILFKLNEIT SDSEKYWLGH TELTDYELEI QVDDFVKSAW KEKQTIFYDP       180
     RFTLAIYINE IKNQYLKKNP DNEKHKSHEI VVPFAWSDWV DLTMLNEELS KPESQRKNCE       240
     YMKATHHIPA KDADYCINNV AITNADLKEM NLPSTKFVPG FAVKKSPTNK ASNEVRMLEG       300
     KSHLLTYAPN PLAIIFLTND GVYEAQIEGK QRIVDSNLFE DFLTSTKNKD PKIIMNPVKE       360
     FNDLLARVKP NPLDPEDDEF GMVAKIKDKN PEKTKEVYLP QKAFNYQQDK IDVQLEEYET       420
     KMKTLHDLTT NELIFDHHTI NKLKLTRNEK IYYEGLKYAN KFELAKEPTY FRMARLNFQT       480
     EENDHDAGWH YEWRFFNGAL RYLKKGWNEE ELLIREKVLL DRILRNWFKF ANEKGIISWI       540
     AHGPLLSWYW DGLLFPFDED IDIQMPAEEL TRFSKLYNQT LVVEDISEGF GKYFIDCSTF       600
     IHHRGKSYKE NHIDARFIDI DTGSYIDITG LGISKEEAPD KYKDIVNQAA IFNQPKPVYN       660
     CRNLHFYSYD EISPLRYTMI GGVPCYIPNK VEDILKDEYT KGMSVYDFEG FYFIDPLNLW       720
     IHQQKLKFLF DQSHAHLFND KEEVTNREEF TNLVKGMNEE QILSLLEHNE DILLEYYLTK       780
     DVTDLHKQEL TYMFNMPDGE NTKIGNINGQ KQQSEISENL EYHKLTSRFK FQKPFRRPLF       840
     NYEKIDKPKH AKPSTA                                                       856
//

If you have problems or comments...

PBIL Back to PBIL home page