(data stored in ACNUC6288 zone)

EMBL: CR382138.PE465

CR382138.PE465       Location/Qualifiers
FT   CDS             complement(920477..921949)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10714g"
FT                   /old_locus_tag="DEHA0F11704g"
FT                   /old_locus_tag="DEHA-IPF8207"
FT                   /old_locus_tag="DEHA-CDS2417.1"
FT                   /product="DEHA2F10714p"
FT                   /note="some similarities with uniprot|P25366 Saccharomyces
FT                   cerevisiae YCR095C Cytoplasmic protein required for
FT                   replication of Brome mosaic virus in S. cerevisiae which is
FT                   a model system for studying replication of positive- strand
FT                   RNA viruses in their natural hosts AND similar to
FT                   CA5000|IPF2023 Candida albicans IPF2023 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10714g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89174"
FT                   /db_xref="InterPro:IPR004861"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLU2"
FT                   /protein_id="CAG89174.2"
FT                   /translation="MLVPPDNFGLVEPGIYRCSKLEPEHFPFLETLQLKSLVVLDAEKP
FT                   PRLLKNFIEANNIEIHNLGGLKISNHNHTGANSSSNKDDNEDDANTETSSVSSKTETGV
FT                   YNLGKSEIETVKLTSKSKNDQWMLIERNIIAGAFELLLNKSKHNILLIDSTSTLVGILR
FT                   KIQKWNFNSIINEYRIYSGNSNKSNYYAENFLELLQTELIPFEIDRLNALLKQQEQREE
FT                   QYQQEQRTQAPPYQYGSSKARSIFRSPDFQISGSRKNSIDSSQLEHQFDDENDNESIDD
FT                   EDIDDELLSASPQIPANLLKLAEMRKQDNPRKESIDSTGSDDDKFTPGTSPKYVRSNRN
FT                   NSLNNDMIQYASRGSYERRYSLADHKFSRPGSFSNGNHKFRNQSISSSSPSIRCSFEGS
FT                   SSLVKRLREREDIEKLKDSKHSKSIDIIPEEARLLRENYDYKFYKKLDKYPISFENVSI
FT                   IKLKLPPDNKLPDWFIKNRDCWEENFRILNKV"
     MLVPPDNFGL VEPGIYRCSK LEPEHFPFLE TLQLKSLVVL DAEKPPRLLK NFIEANNIEI        60
     HNLGGLKISN HNHTGANSSS NKDDNEDDAN TETSSVSSKT ETGVYNLGKS EIETVKLTSK       120
     SKNDQWMLIE RNIIAGAFEL LLNKSKHNIL LIDSTSTLVG ILRKIQKWNF NSIINEYRIY       180
     SGNSNKSNYY AENFLELLQT ELIPFEIDRL NALLKQQEQR EEQYQQEQRT QAPPYQYGSS       240
     KARSIFRSPD FQISGSRKNS IDSSQLEHQF DDENDNESID DEDIDDELLS ASPQIPANLL       300
     KLAEMRKQDN PRKESIDSTG SDDDKFTPGT SPKYVRSNRN NSLNNDMIQY ASRGSYERRY       360
     SLADHKFSRP GSFSNGNHKF RNQSISSSSP SIRCSFEGSS SLVKRLRERE DIEKLKDSKH       420
     SKSIDIIPEE ARLLRENYDY KFYKKLDKYP ISFENVSIIK LKLPPDNKLP DWFIKNRDCW       480
     EENFRILNKV                                                              490
//

If you have problems or comments...

PBIL Back to PBIL home page