(data stored in ACNUC6288 zone)

EMBL: CR382138.PE473

CR382138.PE473       Location/Qualifiers
FT   CDS             complement(936927..939593)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10890g"
FT                   /old_locus_tag="IPF_8194"
FT                   /product="DEHA2F10890p"
FT                   /note="weakly similar to uniprot|Q7SHX8 Neurospora crassa
FT                   NCU00675 Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10890g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66320"
FT                   /db_xref="GOA:Q6BLT4"
FT                   /db_xref="InterPro:IPR039786"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BLT4"
FT                   /protein_id="CAR66320.1"
FT                   /translation="MPIFRPKHQKLILQCYPPGKGVDKKPNPSELSYLLYYASTRRVKL
FT                   EKVVTFLDRKTTSDAKHNRAGNLQVTLTIISSLIEECSENLNVFASFVCSILKSVLQSK
FT                   DLSLCKHAIQTYGVLCSKLDGGLFSGDKVFVDSFGSLSQNLINIGSENSKKRGPNNLEW
FT                   QMISLMTCRYISNCLGYNSKFSKKFIEICIPILTETVHANNKQSNLLTILKSNVNIEDE
FT                   NHHLGRIASTKTNQTSRKAQQDLDNDAVKDSDLNEEALRGLKALFSTSLTSQISEATRA
FT                   IVKNNYATTIDPIWGCTFLEMCTTWIPVQLRFITLSTVLSSLTSLSNKSTKKTSNYPIQ
FT                   LLYANYCLGLVSSDVNMIGLSISDVIQQILFLQANLLLSQSHYFQEEDVKKLSMIYSNC
FT                   ICNLSTHIYYFDQVPDSIREILIKVVSILENSVISGNANSSGVYRFIITLLEDISIIFD
FT                   LLQTKPSNISRNHVSLEDWDLSLILLSSEIGLNPTKDQKPLFSYEQITDIQFKYLRVFG
FT                   YFLNNELVTRNENMETGAINSIESFNVGGDHLQPDYNNYISDPGNFIAHFLGYVDKFFS
FT                   GQSLINIDNASLLQKVLKNMILILGINFINNFVPFFFYWQLPLNPNLVDDNTRIKDTLG
FT                   YTLIYHSLIKMDKIYELNYVRESEFFNSLLGDINYRKLNKLWVNGLQSKEEDAVLDNHH
FT                   ALGHRDENGTLRFNPTKKNLEDFVIGNAFTLSWINPHRPLILDIVNNYIPKKENNQNVL
FT                   SDMSDESSIIENSSYHTSARQNGFGLGLGNANDISSIHSGLLFHQSQNVNMKNAFSNGN
FT                   ETSNGSIYTSDRQYNTPRVSDLKDSVLMKKKPGVAFNEHYNSDTTPGSILSKQMVTSDI
FT                   DSILEGLDIDDDSEIIV"
     MPIFRPKHQK LILQCYPPGK GVDKKPNPSE LSYLLYYAST RRVKLEKVVT FLDRKTTSDA        60
     KHNRAGNLQV TLTIISSLIE ECSENLNVFA SFVCSILKSV LQSKDLSLCK HAIQTYGVLC       120
     SKLDGGLFSG DKVFVDSFGS LSQNLINIGS ENSKKRGPNN LEWQMISLMT CRYISNCLGY       180
     NSKFSKKFIE ICIPILTETV HANNKQSNLL TILKSNVNIE DENHHLGRIA STKTNQTSRK       240
     AQQDLDNDAV KDSDLNEEAL RGLKALFSTS LTSQISEATR AIVKNNYATT IDPIWGCTFL       300
     EMCTTWIPVQ LRFITLSTVL SSLTSLSNKS TKKTSNYPIQ LLYANYCLGL VSSDVNMIGL       360
     SISDVIQQIL FLQANLLLSQ SHYFQEEDVK KLSMIYSNCI CNLSTHIYYF DQVPDSIREI       420
     LIKVVSILEN SVISGNANSS GVYRFIITLL EDISIIFDLL QTKPSNISRN HVSLEDWDLS       480
     LILLSSEIGL NPTKDQKPLF SYEQITDIQF KYLRVFGYFL NNELVTRNEN METGAINSIE       540
     SFNVGGDHLQ PDYNNYISDP GNFIAHFLGY VDKFFSGQSL INIDNASLLQ KVLKNMILIL       600
     GINFINNFVP FFFYWQLPLN PNLVDDNTRI KDTLGYTLIY HSLIKMDKIY ELNYVRESEF       660
     FNSLLGDINY RKLNKLWVNG LQSKEEDAVL DNHHALGHRD ENGTLRFNPT KKNLEDFVIG       720
     NAFTLSWINP HRPLILDIVN NYIPKKENNQ NVLSDMSDES SIIENSSYHT SARQNGFGLG       780
     LGNANDISSI HSGLLFHQSQ NVNMKNAFSN GNETSNGSIY TSDRQYNTPR VSDLKDSVLM       840
     KKKPGVAFNE HYNSDTTPGS ILSKQMVTSD IDSILEGLDI DDDSEIIV                    888
//

If you have problems or comments...

PBIL Back to PBIL home page