(data stored in ACNUC6288 zone)

EMBL: CR382138.PE474

CR382138.PE474       Location/Qualifiers
FT   CDS             941905..944205
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10912g"
FT                   /old_locus_tag="DEHA0F11924g"
FT                   /old_locus_tag="DEHA-IPF8191"
FT                   /old_locus_tag="DEHA-CDS0926.1"
FT                   /product="DEHA2F10912p"
FT                   /note="weakly similar to uniprot|Q12033 Saccharomyces
FT                   cerevisiae YOR275C RIM20 Protein involved in proteolytic
FT                   activation of Rim101p in response to alkaline pH"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10912g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89184"
FT                   /db_xref="InterPro:IPR004328"
FT                   /db_xref="InterPro:IPR025304"
FT                   /db_xref="InterPro:IPR038499"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BLT2"
FT                   /protein_id="CAG89184.2"
FT                   /translation="MNTNLLYIPYRETDIIDLGNELRNIIKMEYFQPSSNFDRDLQAVR
FT                   NLRNNISNLKNEQVNNNDETVCVQYYHQLSNVIKKFPDECVEFSWYGTLGYGRSGPTRS
FT                   RSLRIEQLNILYQLGSYFSQAALMESRYSDEGLKKSCSYLQAAAGCFNSMILQIQKENE
FT                   KETGMIRIPRDLQPETLQFLKSLMIAQAQETIWQKSLASGMKDSVIARLSIQTSEYYST
FT                   AAKYGNSSEFIKLEWINHVTVKQFHFKAAAHYRVSILNHEGFKYGEQVASLQVALSSCD
FT                   SAFRKKKYVNDFVIEDLQGLTETIKSTLRVAEKDNDLVYLKPVPKENDLAPIPGASLVK
FT                   PILPPAIESFDDSSVLFKELLPYLIVQVGQAYRERQDSFIRDSFIDPIQSLNKIMYKFI
FT                   TERNLPASIDTIQKPENLPESIIQHSQEIISYGGTKLIEDSLNEIAKLTLESRHILEGC
FT                   QERLKIEADEDDIMRERQGSQRWARPKSSEASSEFINKINKMEQYLDQAKEGDQFIISQ
FT                   YHEIEPYLQLYCGGYKELIQFIPNSTYVKLDTKINEIIIKLRELINEVSRIENQRKQFL
FT                   TRIEIKARNNNILPSIIDSFKKKQRKLYEENAAIDERSFEDVYAKHITMFNSDLRFLED
FT                   SKHAQIALEGNIDDLNQEFESEYQHTNNESQYKRQEVLQTLENVYTKYLELISNLNEGS
FT                   KFYSDFIIKSNSVLKECDEYVYHRRVEGRELEMFLNNQAVPVESVGSQQSAPDFPPQPM
FT                   GGTWNPNNGIKFG"
     MNTNLLYIPY RETDIIDLGN ELRNIIKMEY FQPSSNFDRD LQAVRNLRNN ISNLKNEQVN        60
     NNDETVCVQY YHQLSNVIKK FPDECVEFSW YGTLGYGRSG PTRSRSLRIE QLNILYQLGS       120
     YFSQAALMES RYSDEGLKKS CSYLQAAAGC FNSMILQIQK ENEKETGMIR IPRDLQPETL       180
     QFLKSLMIAQ AQETIWQKSL ASGMKDSVIA RLSIQTSEYY STAAKYGNSS EFIKLEWINH       240
     VTVKQFHFKA AAHYRVSILN HEGFKYGEQV ASLQVALSSC DSAFRKKKYV NDFVIEDLQG       300
     LTETIKSTLR VAEKDNDLVY LKPVPKENDL APIPGASLVK PILPPAIESF DDSSVLFKEL       360
     LPYLIVQVGQ AYRERQDSFI RDSFIDPIQS LNKIMYKFIT ERNLPASIDT IQKPENLPES       420
     IIQHSQEIIS YGGTKLIEDS LNEIAKLTLE SRHILEGCQE RLKIEADEDD IMRERQGSQR       480
     WARPKSSEAS SEFINKINKM EQYLDQAKEG DQFIISQYHE IEPYLQLYCG GYKELIQFIP       540
     NSTYVKLDTK INEIIIKLRE LINEVSRIEN QRKQFLTRIE IKARNNNILP SIIDSFKKKQ       600
     RKLYEENAAI DERSFEDVYA KHITMFNSDL RFLEDSKHAQ IALEGNIDDL NQEFESEYQH       660
     TNNESQYKRQ EVLQTLENVY TKYLELISNL NEGSKFYSDF IIKSNSVLKE CDEYVYHRRV       720
     EGRELEMFLN NQAVPVESVG SQQSAPDFPP QPMGGTWNPN NGIKFG                      766
//

If you have problems or comments...

PBIL Back to PBIL home page