(data stored in ACNUC6288 zone)

EMBL: CR382138.PE5

CR382138.PE5         Location/Qualifiers
FT   CDS             16091..17515
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F00198g"
FT                   /product="DEHA2F00198p"
FT                   /note="weakly similar to uniprot|P53388 Saccharomyces
FT                   cerevisiae YPL265W DIP5 Dicarboxylic amino acid permease
FT                   mediates high-affinity and high-capacity transport of L-
FT                   glutamate and L-aspartate"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F00198g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66251"
FT                   /db_xref="GOA:B5RU74"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B5RU74"
FT                   /protein_id="CAR66251.1"
FT                   /translation="MRWIGVYGSIFPNELSATGVVMTYWTDKSPSIFINTFSVIVIAVN
FT                   CYNVACFGEVEFWFEMSKLSLVIALVLSGIILDLGGIKDQERLGFRYWIYPRPFAAYFA
FT                   TGSLVRFIDFWKAITTVVYSFGGVQTMFIVFAGEALYPRRTTYRAAKRIFFRAFIMYSS
FT                   PVFVLTLIVPYNNPSIASSTGSAAGSPFVAMKRVGVKGFPHIINGVVLTSALSAQNNAI
FT                   GEGSRYLYVLAAKGQALQSFLKVNKNKLPYVATIAIGMFLPLAYMSVSSGADNVLGWFT
FT                   SLISAYLLLKWITIAVNHILLSRAMRNKSILEIYYLIDSKSQVSHLSSPFFWSVIFLLT
FT                   SDFANFLHGNFVISSFISAYLIIPISLVLYFGYKFIKKMKIKNSSKIKLKQLFQHVVNN
FT                   PEPPFPKKRPWEYIAAIWDRSLCYLEVGDGRVSNLSTIILDVLLNLYLKHVIILFIASL
FT                   YIQILRYKLIHYQIQI"
     MRWIGVYGSI FPNELSATGV VMTYWTDKSP SIFINTFSVI VIAVNCYNVA CFGEVEFWFE        60
     MSKLSLVIAL VLSGIILDLG GIKDQERLGF RYWIYPRPFA AYFATGSLVR FIDFWKAITT       120
     VVYSFGGVQT MFIVFAGEAL YPRRTTYRAA KRIFFRAFIM YSSPVFVLTL IVPYNNPSIA       180
     SSTGSAAGSP FVAMKRVGVK GFPHIINGVV LTSALSAQNN AIGEGSRYLY VLAAKGQALQ       240
     SFLKVNKNKL PYVATIAIGM FLPLAYMSVS SGADNVLGWF TSLISAYLLL KWITIAVNHI       300
     LLSRAMRNKS ILEIYYLIDS KSQVSHLSSP FFWSVIFLLT SDFANFLHGN FVISSFISAY       360
     LIIPISLVLY FGYKFIKKMK IKNSSKIKLK QLFQHVVNNP EPPFPKKRPW EYIAAIWDRS       420
     LCYLEVGDGR VSNLSTIILD VLLNLYLKHV IILFIASLYI QILRYKLIHY QIQI             474
//

If you have problems or comments...

PBIL Back to PBIL home page