(data stored in ACNUC6288 zone)

EMBL: CR382138.PE52

CR382138.PE52        Location/Qualifiers
FT   CDS             114400..115482
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01298g"
FT                   /old_locus_tag="DEHA0F01507g"
FT                   /old_locus_tag="DEHA-IPF9001"
FT                   /old_locus_tag="DEHA-CDS3578.1"
FT                   /product="DEHA2F01298p"
FT                   /note="similar to uniprot|P31116 Saccharomyces cerevisiae
FT                   YJR139C HOM6 Homoserine dehydrogenase (L-homoserine:NADP
FT                   oxidoreductase) dimeric enzyme that catalyzes the third
FT                   step in the common pathway for methionine and threonine
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01298g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88723"
FT                   /db_xref="GOA:Q6BN01"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR022697"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN01"
FT                   /protein_id="CAG88723.1"
FT                   /translation="MVKSVNVAIIGSGVVGSAFVNQLKNLKTAINFNVVYFARSSKEAL
FT                   FSSDYKPVDLASYKNASAQAVLSLDELTKFLKGASKPTILIDNTSNSTIADYYPTFVKE
FT                   GISIATPNKKAFSSDLSVWNEIFKNSEAPSGGLVYHEATVGAGLPIIGPLRDLITTGDK
FT                   VEKIEGIFSGTLSYIFNEFSTTDPSTKVKFSDVVKVAKDLGYTEPDPRDDLNGLDVARK
FT                   VTILARISGFDVESPTSFPVESLIPKELESVQTADEFLSKLPDFDADIQKVKEEALAEN
FT                   KVLRFVGQVDFKANKVSVEIGKYGFDHPFASLKGSDNVVSIKTERYSNPLIIQGAGAGA
FT                   EVTAHGVLADAIKIAERIAI"
     MVKSVNVAII GSGVVGSAFV NQLKNLKTAI NFNVVYFARS SKEALFSSDY KPVDLASYKN        60
     ASAQAVLSLD ELTKFLKGAS KPTILIDNTS NSTIADYYPT FVKEGISIAT PNKKAFSSDL       120
     SVWNEIFKNS EAPSGGLVYH EATVGAGLPI IGPLRDLITT GDKVEKIEGI FSGTLSYIFN       180
     EFSTTDPSTK VKFSDVVKVA KDLGYTEPDP RDDLNGLDVA RKVTILARIS GFDVESPTSF       240
     PVESLIPKEL ESVQTADEFL SKLPDFDADI QKVKEEALAE NKVLRFVGQV DFKANKVSVE       300
     IGKYGFDHPF ASLKGSDNVV SIKTERYSNP LIIQGAGAGA EVTAHGVLAD AIKIAERIAI       360
//

If you have problems or comments...

PBIL Back to PBIL home page