(data stored in ACNUC6288 zone)

EMBL: CR382138.PE61

CR382138.PE61        Location/Qualifiers
FT   CDS             135638..136486
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01496g"
FT                   /old_locus_tag="DEHA0F01760g"
FT                   /old_locus_tag="DEHA-IPF8984"
FT                   /old_locus_tag="DEHA-CDS4442.1"
FT                   /product="DEHA2F01496p"
FT                   /note="highly similar to uniprot|P30656 Saccharomyces
FT                   cerevisiae YPR103W PRE2 20S proteasome beta-type subunit
FT                   responsible for the chymotryptic activity of the
FT                   proteasome"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01496g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88735"
FT                   /db_xref="GOA:Q6BMZ2"
FT                   /db_xref="InterPro:IPR000243"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMZ2"
FT                   /protein_id="CAG88735.1"
FT                   /translation="MNAIAQKFTHSNTNSVLKEINEAKSEFAENAQLDLAPSIQLPPIS
FT                   QPTDFLRAHTDDASNPDCKIKIAHGTTTMAFRFQGGIVVAVDSRATQGNWIASQTVNKV
FT                   IRINPDLLGTMAGGAADCQYWETWLGTQCRLHELREKERISVAAASKILSNLVYEYKGM
FT                   GLSMGTMICGYTKKEGPTIYYVDSDGSRLKGEMFCVGSGQTFAYGVLDSEYRWDLSVEE
FT                   ALYLGKRSILAATHRDAYSGGSVNLYHVTEAGWVYHGNHNVGDIFWDIKEKEKSFNNVD
FT                   G"
     MNAIAQKFTH SNTNSVLKEI NEAKSEFAEN AQLDLAPSIQ LPPISQPTDF LRAHTDDASN        60
     PDCKIKIAHG TTTMAFRFQG GIVVAVDSRA TQGNWIASQT VNKVIRINPD LLGTMAGGAA       120
     DCQYWETWLG TQCRLHELRE KERISVAAAS KILSNLVYEY KGMGLSMGTM ICGYTKKEGP       180
     TIYYVDSDGS RLKGEMFCVG SGQTFAYGVL DSEYRWDLSV EEALYLGKRS ILAATHRDAY       240
     SGGSVNLYHV TEAGWVYHGN HNVGDIFWDI KEKEKSFNNV DG                          282
//

If you have problems or comments...

PBIL Back to PBIL home page