(data stored in ACNUC6288 zone)

EMBL: CR382138.PE65

CR382138.PE65        Location/Qualifiers
FT   CDS             139662..141353
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01584g"
FT                   /old_locus_tag="DEHA0F01848g"
FT                   /old_locus_tag="DEHA-IPF8980"
FT                   /old_locus_tag="DEHA-CDS1864.1"
FT                   /product="DEHA2F01584p"
FT                   /note="weakly similar to uniprot|Q06834 Saccharomyces
FT                   cerevisiae YPR093C ASR1 Protein involved in a putative
FT                   alcohol-responsive signaling pathway"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01584g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88739"
FT                   /db_xref="GOA:Q6BMY8"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMY8"
FT                   /protein_id="CAG88739.2"
FT                   /translation="MSLAIKEEECTICLEVITFASTIGTIKNCHHYYHEDCILQWSSHS
FT                   NSCPTCRKLFYKIDVSRHDEPNKIRKSISIRDKLLPNDAIDQIPQEYIIPMNSPSTDRE
FT                   NSHSTLDQITEHYSSNNKLCSICSSSDYRSSLSRNLIYCNNCPSAFHLNCLGVNAYEEF
FT                   DDLTWCCPMCDSLQDLSAMPTYQSGVSNRSRSSRGAGNIRPRANRIRTPRTTTSTSSLN
FT                   SHITDAIFRNASVPINVVPRVDNLNVTSERISRENSKRRPGLIIHNENGELDDDFLYDN
FT                   SNPEDETNIRAENNRVYSPPIINGGVILRKELKEKQKLSKEEARSWDVFDEARKCKVDS
FT                   ESSNAVKSIAQKTEEPRARRRRKKLSDLPHPNPNPELIEGTSANLQNVSEKKQEKTRIS
FT                   SLISQLRSQQTGCKYERNVITTSTTPEISTGISLNPTESISGDSGASSDSETKSQRKKA
FT                   CIDKPTSMELSLEQKVEIQKHIRNNLRPLYRPGDSNPSCSPMIRSEEIYIEINKSASRK
FT                   IYAHILSLITSETDESKCIEYFNDDETKLKSIVEKFVRDELRYYKW"
     MSLAIKEEEC TICLEVITFA STIGTIKNCH HYYHEDCILQ WSSHSNSCPT CRKLFYKIDV        60
     SRHDEPNKIR KSISIRDKLL PNDAIDQIPQ EYIIPMNSPS TDRENSHSTL DQITEHYSSN       120
     NKLCSICSSS DYRSSLSRNL IYCNNCPSAF HLNCLGVNAY EEFDDLTWCC PMCDSLQDLS       180
     AMPTYQSGVS NRSRSSRGAG NIRPRANRIR TPRTTTSTSS LNSHITDAIF RNASVPINVV       240
     PRVDNLNVTS ERISRENSKR RPGLIIHNEN GELDDDFLYD NSNPEDETNI RAENNRVYSP       300
     PIINGGVILR KELKEKQKLS KEEARSWDVF DEARKCKVDS ESSNAVKSIA QKTEEPRARR       360
     RRKKLSDLPH PNPNPELIEG TSANLQNVSE KKQEKTRISS LISQLRSQQT GCKYERNVIT       420
     TSTTPEISTG ISLNPTESIS GDSGASSDSE TKSQRKKACI DKPTSMELSL EQKVEIQKHI       480
     RNNLRPLYRP GDSNPSCSPM IRSEEIYIEI NKSASRKIYA HILSLITSET DESKCIEYFN       540
     DDETKLKSIV EKFVRDELRY YKW                                               563
//

If you have problems or comments...

PBIL Back to PBIL home page