(data stored in ACNUC6288 zone)

EMBL: CR382138.PE72

CR382138.PE72        Location/Qualifiers
FT   CDS             152133..152822
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01738g"
FT                   /old_locus_tag="DEHA0F02002g"
FT                   /old_locus_tag="DEHA-IPF8970"
FT                   /old_locus_tag="DEHA-CDS4759.1"
FT                   /product="DEHA2F01738p"
FT                   /note="weakly similar to uniprot|Q06563 Saccharomyces
FT                   cerevisiae YLR251w SYM1 Protein and similar to
FT                   CA3605|IPF3865 Candida albicans IPF3865 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01738g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88746"
FT                   /db_xref="GOA:Q6BMY1"
FT                   /db_xref="InterPro:IPR007248"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMY1"
FT                   /protein_id="CAG88746.2"
FT                   /translation="MSFFDKYNRLLKTHPFRVNMVTTGLLFGVGDGVAQKLFPSNHDHL
FT                   DEEKPKYNVYRTMRAMIYGSCFFAPCGVLWYGKRLPLIKNPFVSVKNRETWSKNRVHLY
FT                   DTLYRVAIDQIFIPGLFWIPMYNIVMSTLSGYENPLEVAFHKLQHNWWNVLTTNWMVWP
FT                   GFQLISFFYIPVHLRIVAANICSVGWNCFLSYLYNGKAHGDHQKEEILDHLVDPDEEIE
FT                   ETTMVVY"
     MSFFDKYNRL LKTHPFRVNM VTTGLLFGVG DGVAQKLFPS NHDHLDEEKP KYNVYRTMRA        60
     MIYGSCFFAP CGVLWYGKRL PLIKNPFVSV KNRETWSKNR VHLYDTLYRV AIDQIFIPGL       120
     FWIPMYNIVM STLSGYENPL EVAFHKLQHN WWNVLTTNWM VWPGFQLISF FYIPVHLRIV       180
     AANICSVGWN CFLSYLYNGK AHGDHQKEEI LDHLVDPDEE IEETTMVVY                   229
//

If you have problems or comments...

PBIL Back to PBIL home page