(data stored in ACNUC6288 zone)

EMBL: CR382138.PE74

CR382138.PE74        Location/Qualifiers
FT   CDS             154574..156829
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01782g"
FT                   /product="DEHA2F01782p"
FT                   /note="similar to uniprot|P38903 Saccharomyces cerevisiae
FT                   YOR014w RTS1 B-type regulatory subunit of protein
FT                   phosphatase 2A (PP2A)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01782g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66256"
FT                   /db_xref="GOA:B5RU79"
FT                   /db_xref="InterPro:IPR002554"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:B5RU79"
FT                   /protein_id="CAR66256.1"
FT                   /translation="MMKGFKNRLSRNKGQSTGKKGEKKLDKDKDSKSDSSSRKASSSSS
FT                   IASKLSGSGSNAKSSSPSISRHNSGNSIKSSSSGGSATAMGQTSHSPQSPNQSQQDSPR
FT                   ILINDSENNDSPTMVTTAGSNTQPVTPTPTSPTTVTNTSPNASNSPFDQVQIKPGHVPH
FT                   SQTGSAIHPHGYPLNTNISSPTRDNFDIDLIVTPKRHSSSRFEPSTSDRYQEIVKLPNF
FT                   DEILPEEQISLFIQKIDQCNIMFDFSDPTYDGRGKEIKRITLQELIHFISNNRFTYTDE
FT                   MYKHVVGMFKKNLFRPIPPPVNPIGDIYDPDEDEPVSELAWPHMQAIYEFFLRFIESPD
FT                   FTHQIAKQYIDHEFILKILELFDSEDPRERDCLKTTLHRIYGKFLSLRSFIRKSINNVF
FT                   LQFVYETERFNGIGELLEILGSIINGFALPLKDEHKIFLVRILIPLHKVKSLSLYHPQL
FT                   AYCIVQFLEKDPMLTEDVIMGLLRFWPKINSPKEVMFLNEIEDIFEVMEPNEFLKIQIP
FT                   LFAQLSKCISSPHFQVSEKVLCYWTNEYFLTLITENAEVVLPIIFASLYELTNATQPGI
FT                   TNGTVQQRLLENPESPTDANGNLIDRGLILNDLNNHSIDHNTNVNDSLNPNMHDITDEE
FT                   YYDSFSSPQQVQGDLDEFGTPNQIPPHNSATSNWNRSIHSLAFGALKVFMDHNPILYDH
FT                   CTMLYHQSLEEQRAREVARKDGWKKVEEYVNSLRLQQSSSALSGKNSNDNGASVASH"
     MMKGFKNRLS RNKGQSTGKK GEKKLDKDKD SKSDSSSRKA SSSSSIASKL SGSGSNAKSS        60
     SPSISRHNSG NSIKSSSSGG SATAMGQTSH SPQSPNQSQQ DSPRILINDS ENNDSPTMVT       120
     TAGSNTQPVT PTPTSPTTVT NTSPNASNSP FDQVQIKPGH VPHSQTGSAI HPHGYPLNTN       180
     ISSPTRDNFD IDLIVTPKRH SSSRFEPSTS DRYQEIVKLP NFDEILPEEQ ISLFIQKIDQ       240
     CNIMFDFSDP TYDGRGKEIK RITLQELIHF ISNNRFTYTD EMYKHVVGMF KKNLFRPIPP       300
     PVNPIGDIYD PDEDEPVSEL AWPHMQAIYE FFLRFIESPD FTHQIAKQYI DHEFILKILE       360
     LFDSEDPRER DCLKTTLHRI YGKFLSLRSF IRKSINNVFL QFVYETERFN GIGELLEILG       420
     SIINGFALPL KDEHKIFLVR ILIPLHKVKS LSLYHPQLAY CIVQFLEKDP MLTEDVIMGL       480
     LRFWPKINSP KEVMFLNEIE DIFEVMEPNE FLKIQIPLFA QLSKCISSPH FQVSEKVLCY       540
     WTNEYFLTLI TENAEVVLPI IFASLYELTN ATQPGITNGT VQQRLLENPE SPTDANGNLI       600
     DRGLILNDLN NHSIDHNTNV NDSLNPNMHD ITDEEYYDSF SSPQQVQGDL DEFGTPNQIP       660
     PHNSATSNWN RSIHSLAFGA LKVFMDHNPI LYDHCTMLYH QSLEEQRARE VARKDGWKKV       720
     EEYVNSLRLQ QSSSALSGKN SNDNGASVAS H                                      751
//

If you have problems or comments...

PBIL Back to PBIL home page