(data stored in ACNUC6288 zone)

EMBL: CR382138.PE83

CR382138.PE83        Location/Qualifiers
FT   CDS             174737..175381
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01980g"
FT                   /old_locus_tag="DEHA0F02244g"
FT                   /old_locus_tag="DEHA-IPF8945"
FT                   /old_locus_tag="DEHA-CDS5218.1"
FT                   /product="DEHA2F01980p"
FT                   /note="highly similar to uniprot|P32835 Saccharomyces
FT                   cerevisiae YLR293C GSP1 GTP binding protein (mammalian Ranp
FT                   homolog) involved in the maintenance of nuclear
FT                   organization RNA processing and transport"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01980g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88757"
FT                   /db_xref="GOA:Q6BMX0"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR002041"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMX0"
FT                   /protein_id="CAG88757.1"
FT                   /translation="MAQEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATLGVEVH
FT                   PLGFHTNFGELKFDVWDTAGQEKFGGLRDGYYINGQCGIIMFDVTSRITYKNVPNWHRD
FT                   LVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLAR
FT                   KLVGNPQLEFVASPALAPPEVQVDADLMQRYQQEMEQATALPLPDEDDADL"
     MAQEVPTFKL VLVGDGGTGK TTFVKRHLTG EFEKKYIATL GVEVHPLGFH TNFGELKFDV        60
     WDTAGQEKFG GLRDGYYING QCGIIMFDVT SRITYKNVPN WHRDLVRVCE NIPIVLCGNK       120
     VDVKERKVKA KTITFHRKKN LQYYDISAKS NYNFEKPFLW LARKLVGNPQ LEFVASPALA       180
     PPEVQVDADL MQRYQQEMEQ ATALPLPDED DADL                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page