(data stored in ACNUC6288 zone)

EMBL: CR382138.PE86

CR382138.PE86        Location/Qualifiers
FT   CDS             177614..178867
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02046g"
FT                   /old_locus_tag="DEHA0F02310g"
FT                   /old_locus_tag="DEHA-IPF8942"
FT                   /old_locus_tag="DEHA-CDS3019.1"
FT                   /product="DEHA2F02046p"
FT                   /note="similar to uniprot|Q59P70 Candida albicans Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02046g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88760"
FT                   /db_xref="InterPro:IPR021622"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMW7"
FT                   /protein_id="CAG88760.1"
FT                   /translation="MASESPYLDTESILNASDLINSTLISKGYITEKLNFNSINWKDLV
FT                   QDQIENNIQELAKLDELKVTETIYNNDKNIINIIYSLLQSIERNKAQNKSFNKVISKKD
FT                   STIRDLQKKIESLEHQVDQSESRLNRFVQIDQLQLSKRVQDLSHVNKLQTQDLNKLKNW
FT                   CTDIKTKYHVKLKKKNIEIDHLKNQLLDKKNLSTTTTFGIPLSYDSSRNNDTTSFDQDI
FT                   NSNIIYNHNPIIDNTNPNTHLNSSLQPVLNKQYEQIVIDLTQLIENLISENHKFSRFIK
FT                   LINNYYQSLNIQLSNINHKHLDVRSLPNPSDLIDLNEFTGDLDPANINSKDSLDEIESF
FT                   EYITKPLLNNVYKNYHYVSNLVELVDSNSAQINENENGFSSKKIDELKTELEIVTRNWQ
FT                   DAIKTLENWKNYQQTNDD"
     MASESPYLDT ESILNASDLI NSTLISKGYI TEKLNFNSIN WKDLVQDQIE NNIQELAKLD        60
     ELKVTETIYN NDKNIINIIY SLLQSIERNK AQNKSFNKVI SKKDSTIRDL QKKIESLEHQ       120
     VDQSESRLNR FVQIDQLQLS KRVQDLSHVN KLQTQDLNKL KNWCTDIKTK YHVKLKKKNI       180
     EIDHLKNQLL DKKNLSTTTT FGIPLSYDSS RNNDTTSFDQ DINSNIIYNH NPIIDNTNPN       240
     THLNSSLQPV LNKQYEQIVI DLTQLIENLI SENHKFSRFI KLINNYYQSL NIQLSNINHK       300
     HLDVRSLPNP SDLIDLNEFT GDLDPANINS KDSLDEIESF EYITKPLLNN VYKNYHYVSN       360
     LVELVDSNSA QINENENGFS SKKIDELKTE LEIVTRNWQD AIKTLENWKN YQQTNDD          417
//

If you have problems or comments...

PBIL Back to PBIL home page