(data stored in ACNUC6288 zone)

EMBL: CR382138.PE90

CR382138.PE90        Location/Qualifiers
FT   CDS             183570..186017
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02134g"
FT                   /old_locus_tag="DEHA0F02398g"
FT                   /old_locus_tag="DEHA-IPF8936"
FT                   /old_locus_tag="DEHA-CDS0793.1"
FT                   /product="DEHA2F02134p"
FT                   /note="similar to uniprot|Q06224 Saccharomyces cerevisiae
FT                   YLR277C YSH1 subunit of Polyadenylation factor I (PF I)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02134g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88764"
FT                   /db_xref="GOA:Q6BMW3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR021718"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMW3"
FT                   /protein_id="CAG88764.2"
FT                   /translation="MTVDSQPADGTDDFKFFGLGGCNEVGRSCHIIEYKNKVIMLDAGV
FT                   HPGLQGLSSLPFYDEYDLSKVDILLVSHFHLDHAASLPYVMQHTNFNGRVFMTHATKAI
FT                   YRWLLSDFVKVTSIGGGSDARLNNSDPNANTGSSNLYTDDDLMRSFDRIETIDYHSTIE
FT                   LDGIRFTAYHAGHVLGACMYFIEIGGLKVLFTGDYSSEEDRHLQVAEVPPIKPDILITE
FT                   STFGTATHEPRLEKETRMTNIIHSTLLKGGRILMPVFALGRAQELLLILEEYWSLNDDL
FT                   QNINIYYASSLARKCMAVYQTYTNIMNDSIRLTTSATNSSKKQNPFQFKFIKSIKNLDK
FT                   FQDFGPCVVVASPGMLQNGVSRELLERWAPDPKNAVIMTGYSVEGTMAKDLLTEPHTIQ
FT                   SAMNSDMTIPRRLSIEEISFAAHVDFQQNASFIEKVNPSKIILVHGESNPMGRLKSALL
FT                   SKYASRKGTEQEVKVFNPRNCDEVTIGIKGLKVAKVLGTLAEEQLSYLKKEISTQIKKD
FT                   NVKIEELSDDNMDKETMPESDEKADKESEDTKNDIDKNNDENANEKNIISTGKALSGVL
FT                   VSKDFDLNLLQLQDLHEFTQLSTSIVKSKINLKINADISLMKWHLEQMFGFISILADDE
FT                   ETWECVIMDMIDISVEKNNSQSAGGLLINVEWVNDNLMADSLADSVIAILYSIDSSPAS
FT                   VKLTSKSCSHSHNKVKEEVDDDAMIESTPPPEKNAHANSEISSRIHRITSLLKAQFGDS
FT                   LKTAAGEEGKKATIVIGKNEAKIDYLNLTVDCNSRVLRDRIENIIKRGCGLAAPLSQYE
FT                   KTT"
     MTVDSQPADG TDDFKFFGLG GCNEVGRSCH IIEYKNKVIM LDAGVHPGLQ GLSSLPFYDE        60
     YDLSKVDILL VSHFHLDHAA SLPYVMQHTN FNGRVFMTHA TKAIYRWLLS DFVKVTSIGG       120
     GSDARLNNSD PNANTGSSNL YTDDDLMRSF DRIETIDYHS TIELDGIRFT AYHAGHVLGA       180
     CMYFIEIGGL KVLFTGDYSS EEDRHLQVAE VPPIKPDILI TESTFGTATH EPRLEKETRM       240
     TNIIHSTLLK GGRILMPVFA LGRAQELLLI LEEYWSLNDD LQNINIYYAS SLARKCMAVY       300
     QTYTNIMNDS IRLTTSATNS SKKQNPFQFK FIKSIKNLDK FQDFGPCVVV ASPGMLQNGV       360
     SRELLERWAP DPKNAVIMTG YSVEGTMAKD LLTEPHTIQS AMNSDMTIPR RLSIEEISFA       420
     AHVDFQQNAS FIEKVNPSKI ILVHGESNPM GRLKSALLSK YASRKGTEQE VKVFNPRNCD       480
     EVTIGIKGLK VAKVLGTLAE EQLSYLKKEI STQIKKDNVK IEELSDDNMD KETMPESDEK       540
     ADKESEDTKN DIDKNNDENA NEKNIISTGK ALSGVLVSKD FDLNLLQLQD LHEFTQLSTS       600
     IVKSKINLKI NADISLMKWH LEQMFGFISI LADDEETWEC VIMDMIDISV EKNNSQSAGG       660
     LLINVEWVND NLMADSLADS VIAILYSIDS SPASVKLTSK SCSHSHNKVK EEVDDDAMIE       720
     STPPPEKNAH ANSEISSRIH RITSLLKAQF GDSLKTAAGE EGKKATIVIG KNEAKIDYLN       780
     LTVDCNSRVL RDRIENIIKR GCGLAAPLSQ YEKTT                                  815
//

If you have problems or comments...

PBIL Back to PBIL home page