(data stored in ACNUC6288 zone)

EMBL: CR382138.PE91

CR382138.PE91        Location/Qualifiers
FT   CDS             join(186181..186185,186247..186589)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02156g"
FT                   /product="DEHA2F02156p"
FT                   /note="similar to uniprot|Q06217 Saccharomyces cerevisiae
FT                   YLR275w SMD2 U1 snRNP protein of the Sm class"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02156g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88765"
FT                   /db_xref="GOA:Q6BMW2"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR027248"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMW2"
FT                   /protein_id="CAG88765.1"
FT                   /translation="MAELIDRPRSELTELELQKLEEFEFTHGPMSLLQNAVNNGSPVVI
FT                   SCRNNHKLIAKVKAFDRHCNLILENVKELWTESVKNNKGKKIKSTSKERFVSKMFLRGD
FT                   SVVIVLKAQAS"
     MAELIDRPRS ELTELELQKL EEFEFTHGPM SLLQNAVNNG SPVVISCRNN HKLIAKVKAF        60
     DRHCNLILEN VKELWTESVK NNKGKKIKST SKERFVSKMF LRGDSVVIVL KAQAS            115
//

If you have problems or comments...

PBIL Back to PBIL home page