(data stored in ACNUC6288 zone)

EMBL: CR382138.PE98

CR382138.PE98        Location/Qualifiers
FT   CDS             196917..198716
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02354g"
FT                   /old_locus_tag="DEHA0F02640g"
FT                   /old_locus_tag="DEHA-IPF8925"
FT                   /old_locus_tag="DEHA-CDS1708.1"
FT                   /product="DEHA2F02354p"
FT                   /note="weakly similar to uniprot|P38687 Saccharomyces
FT                   cerevisiae YPL243W SRP68 Component of the signal
FT                   recognition particle (SRP) ribonucleoprotein (RNP) complex
FT                   that functions in protein targeting to the endoplasmic
FT                   reticulum (ER) membrane and similar to CA5902|CaSRP68
FT                   Candida albicans CaSRP68"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02354g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88773"
FT                   /db_xref="GOA:Q6BMV4"
FT                   /db_xref="InterPro:IPR026258"
FT                   /db_xref="InterPro:IPR034652"
FT                   /db_xref="InterPro:IPR038253"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMV4"
FT                   /protein_id="CAG88773.2"
FT                   /translation="MEYPLIVTLGARMSAYLSSSEDYHKQRKRLNKRLLKLRHELDLIT
FT                   PDTKDYKKKEKISKISSSDYDQDEKYGLLLLLTAERDSLYSSEIKSLLEISNDNASSYR
FT                   NLMISRIKKSLSSSKKLLEITVNEKDEYKRIEYYTYAALIQGNLSVNKKQWSKALNAFS
FT                   IAKCALDFLYSQEDSKMDIEEEQEESTQFKKTLISEITETLVDPSLALAISQDDTAYST
FT                   TTDLKTVSRQHCRDNKLSYLQPVIEIIARIDPEAVSEVSSSTELIKSVQWRDHEATLYN
FT                   DELAYKIMKLTNDNETNWKNFNDANQFDVLLSGWSELLEIHTNDMDKNKDEDDLEKVQD
FT                   RAIVLTYINFNLLFTRLKRDLLIIDQLSSQGDNVFALKKLEFNKDIIRLYGTIITTTQE
FT                   IKDLPGVYNDEDLHESLDNLEKFFVAKKSAVLARSFALNNKFPEALKIFDHVDNTLSSS
FT                   DNKFYKIDEFPYNVSSNVEFEKFKKELPSQVLQAQILAQFSVDLSKNLNQSNFVIENMN
FT                   KYPVSNETLDNIANFNKNLSIAPVLSKPVLFDIGFNYINYGMGRSSSYNNSNSATSTTS
FT                   DSTTDQNDPNKKKSGFFGIFGRS"
     MEYPLIVTLG ARMSAYLSSS EDYHKQRKRL NKRLLKLRHE LDLITPDTKD YKKKEKISKI        60
     SSSDYDQDEK YGLLLLLTAE RDSLYSSEIK SLLEISNDNA SSYRNLMISR IKKSLSSSKK       120
     LLEITVNEKD EYKRIEYYTY AALIQGNLSV NKKQWSKALN AFSIAKCALD FLYSQEDSKM       180
     DIEEEQEEST QFKKTLISEI TETLVDPSLA LAISQDDTAY STTTDLKTVS RQHCRDNKLS       240
     YLQPVIEIIA RIDPEAVSEV SSSTELIKSV QWRDHEATLY NDELAYKIMK LTNDNETNWK       300
     NFNDANQFDV LLSGWSELLE IHTNDMDKNK DEDDLEKVQD RAIVLTYINF NLLFTRLKRD       360
     LLIIDQLSSQ GDNVFALKKL EFNKDIIRLY GTIITTTQEI KDLPGVYNDE DLHESLDNLE       420
     KFFVAKKSAV LARSFALNNK FPEALKIFDH VDNTLSSSDN KFYKIDEFPY NVSSNVEFEK       480
     FKKELPSQVL QAQILAQFSV DLSKNLNQSN FVIENMNKYP VSNETLDNIA NFNKNLSIAP       540
     VLSKPVLFDI GFNYINYGMG RSSSYNNSNS ATSTTSDSTT DQNDPNKKKS GFFGIFGRS        599
//

If you have problems or comments...

PBIL Back to PBIL home page