(data stored in SCRATCH zone)

EMBL: CR848038.ACPS

CR848038.ACPS        Location/Qualifiers
FT   CDS             complement(524702..525070)
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="CAB455"
FT                   /product="holo-[acyl-carrier protein] synthase"
FT                   /EC_number="2.7.8.7"
FT                   /note="Similar to many including: Escherichia coli
FT                   holo-[acyl-carrier protein] synthase AcpS or
FT                   SWALL:ACPS_ECOLI (SWALL:P24224) (125 aa) fasta scores: E():
FT                   6e-06, 32.23% id in 121 aa and Clostridium perfringens
FT                   holo-[acyl-carrier protein] synthase AcpS or cpe0291
FT                   SWALL:ACPS_CLOPE (SWALL:Q8XNP1) (133 aa) fasta scores: E():
FT                   1.6e-08, 43.2% id in 125 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB455"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63908"
FT                   /db_xref="GOA:Q5L623"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L623"
FT                   /protein_id="CAH63908.1"
FT                   /translation="MQIAHIGTDIIEISRIRKAIKTHNQRMLNKIFTKKEQVYCLRLID
FT                   PCPSLAARFAGKEAVAKALGTGIGKIVGWKDIEILKISKQPEVFLPERVYQKLGISKVL
FT                   LSISHSREYATAMAIALI"
     MQIAHIGTDI IEISRIRKAI KTHNQRMLNK IFTKKEQVYC LRLIDPCPSL AARFAGKEAV        60
     AKALGTGIGK IVGWKDIEIL KISKQPEVFL PERVYQKLGI SKVLLSISHS REYATAMAIA       120
     LI                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page