(data stored in SCRATCH zone)

EMBL: CR848038.ATOS

CR848038.ATOS        Location/Qualifiers
FT   CDS             complement(167548..168600)
FT                   /transl_table=11
FT                   /gene="atoS"
FT                   /locus_tag="CAB155"
FT                   /product="putative 2-component regulatory system-sensor
FT                   histidine kinase"
FT                   /note="Similar to Chlamydia trachomatis 2-component
FT                   regulatory system-sensor histidine kinase atos or ct467
FT                   SWALL:O84473 (EMBL:AE001320) (352 aa) fasta scores: E():
FT                   4.9e-85, 64.82% id in 344 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB155"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63613"
FT                   /db_xref="GOA:Q5L6V7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6V7"
FT                   /protein_id="CAH63613.1"
FT                   /translation="MSNNDCKSCSSTQELMEIKSRITQSYKEADTILTAIPDGIILISE
FT                   VGNILICNSQAREILGIPDELEILHKPFTDFFPETFFGFSLNEALVSLPSPKTLRLTLS
FT                   KNDQDRDVEIFVRKNPLNGFLFLLIRDRSEYKQLENVIERYKNIAELGKMTATLAHEIR
FT                   NPLSGIAGFASLLKEELPSPRHQRMLASIIDGTRSLNTLVSSMLEYTKSQPLNLKAIDL
FT                   QEFFSSLIPLLSITFPFCTFERETSTSIVRSIDPDRMNSVVWNLVKNAAEATESPITLT
FT                   LHKSGDISVTNPGQLPQEILDKLFIPFFTTKAQGNGLGLAEALKIMRLHGGGIHVENAN
FT                   GHITFTLKLP"
     MSNNDCKSCS STQELMEIKS RITQSYKEAD TILTAIPDGI ILISEVGNIL ICNSQAREIL        60
     GIPDELEILH KPFTDFFPET FFGFSLNEAL VSLPSPKTLR LTLSKNDQDR DVEIFVRKNP       120
     LNGFLFLLIR DRSEYKQLEN VIERYKNIAE LGKMTATLAH EIRNPLSGIA GFASLLKEEL       180
     PSPRHQRMLA SIIDGTRSLN TLVSSMLEYT KSQPLNLKAI DLQEFFSSLI PLLSITFPFC       240
     TFERETSTSI VRSIDPDRMN SVVWNLVKNA AEATESPITL TLHKSGDISV TNPGQLPQEI       300
     LDKLFIPFFT TKAQGNGLGL AEALKIMRLH GGGIHVENAN GHITFTLKLP                  350
//

If you have problems or comments...

PBIL Back to PBIL home page