(data stored in SCRATCH zone)

EMBL: CR848038.DNAF

CR848038.DNAF        Location/Qualifiers
FT   CDS             100784..101533
FT                   /transl_table=11
FT                   /gene="dnaF"
FT                   /gene_synonym="dnaQ_2"
FT                   /gene_synonym="polC"
FT                   /locus_tag="CAB085"
FT                   /product="putative DNA polymerase III epsilon chain"
FT                   /note="Similar to Chlamydia pneumoniae DNA polymerase III
FT                   epsilon chain DnaQ_2 or cpn0655 or cp0092 SWALL:Q9Z7P9
FT                   (EMBL:AE001648) (249 aa) fasta scores: E(): 2.9e-86, 87.55%
FT                   id in 249 aa, and to Bacillus subtilis DNA polymerase III
FT                   PolC-type or DnaF or MutI SWALL:DPO3_BACSU (SWALL:P13267)
FT                   (1437 aa) fasta scores: E(): 1.4e-10, 32.7% id in 159 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB085"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63542"
FT                   /db_xref="GOA:Q5L728"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR024530"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L728"
FT                   /protein_id="CAH63542.1"
FT                   /translation="MTLLKDTVFVCLDCEMTGLDVKKDRIIEFAAIRFTFDSVIDSMET
FT                   LINPDRVISAESQRIHHISDAMLKDQPRIAEVFPKIKSFLKEGDYIVGHSVGFDLQVLS
FT                   QEAERIGETFLSKYYIIDTLRLAKEYGDSPNNSLEALAVHFNVPYDGNHRAMKDVEINI
FT                   SIFKHFCKRFRTIEQLKQMLSKPIKMKYMPLGKHKGRCFSEIPLSYLQWASKMDFDPDL
FT                   LFSIRHEIKHRQKGIGFTQVNNPFIGL"
     MTLLKDTVFV CLDCEMTGLD VKKDRIIEFA AIRFTFDSVI DSMETLINPD RVISAESQRI        60
     HHISDAMLKD QPRIAEVFPK IKSFLKEGDY IVGHSVGFDL QVLSQEAERI GETFLSKYYI       120
     IDTLRLAKEY GDSPNNSLEA LAVHFNVPYD GNHRAMKDVE INISIFKHFC KRFRTIEQLK       180
     QMLSKPIKMK YMPLGKHKGR CFSEIPLSYL QWASKMDFDP DLLFSIRHEI KHRQKGIGFT       240
     QVNNPFIGL                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page