(data stored in SCRATCH zone)

EMBL: CR848038.DPPD

CR848038.DPPD        Location/Qualifiers
FT   CDS             complement(72989..73951)
FT                   /transl_table=11
FT                   /gene="dppD"
FT                   /locus_tag="CAB059"
FT                   /product="putative peptide ABC transport ATP-binding
FT                   protein"
FT                   /note="Similar to Chlamydia pneumoniae ABC ATPase dipeptide
FT                   transport dppD or cpn0682 or cp0065 SWALL:Q9Z7M2
FT                   (EMBL:AE001650) (324 aa) fasta scores: E(): 3.3e-73, 68.73%
FT                   id in 323 aa."
FT                   /db_xref="EnsemblGenomes-Gn:CAB059"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63517"
FT                   /db_xref="GOA:Q5L751"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L751"
FT                   /protein_id="CAH63517.1"
FT                   /translation="MTHPPILQVKDLSVSLHKRRAHYPIVESLSFDLHKGKTLAIIGES
FT                   GSGKSVTAQALMQLLPSPLFSTSGEILFHGKDLFKAPRGILRSIFGTKISMIFQNPQSS
FT                   LNPVFTIEQQFQELIRTHLHLPTQEGKNKIIQALIDTGFHNPELCLKLYPHQLSGGMLQ
FT                   RVSIAMALLTSPEILIADEPTTALDVSVQYQILQLLKGLQNKLGMALLIITHNMGVVAE
FT                   TADDVLVLYAGRLAEYAPVKDIFHNPCHPYTQDLLASRPSLQSETFTTIPGQPPHYSAL
FT                   PSGCCYYPRCSKAYGKCKVESPEAQQVTEGHKVRCWLYE"
     MTHPPILQVK DLSVSLHKRR AHYPIVESLS FDLHKGKTLA IIGESGSGKS VTAQALMQLL        60
     PSPLFSTSGE ILFHGKDLFK APRGILRSIF GTKISMIFQN PQSSLNPVFT IEQQFQELIR       120
     THLHLPTQEG KNKIIQALID TGFHNPELCL KLYPHQLSGG MLQRVSIAMA LLTSPEILIA       180
     DEPTTALDVS VQYQILQLLK GLQNKLGMAL LIITHNMGVV AETADDVLVL YAGRLAEYAP       240
     VKDIFHNPCH PYTQDLLASR PSLQSETFTT IPGQPPHYSA LPSGCCYYPR CSKAYGKCKV       300
     ESPEAQQVTE GHKVRCWLYE                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page