(data stored in SCRATCH zone)

EMBL: CR848038.FABG

CR848038.FABG        Location/Qualifiers
FT   CDS             545023..545769
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="CAB472"
FT                   /product="3-oxoacyl-[acyl-carrier protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="Similar to Escherichia coli, and Shigella flexneri
FT                   3-oxoacyl-[acyl-carrier protein] reductase FabG or b1093 or
FT                   sf1097 or s1177 SWALL:FABG_ECOLI (SWALL:P25716) (244 aa)
FT                   fasta scores: E(): 5.3e-39, 51.25% id in 240 aa, and to
FT                   Vibrio harveyi 3-oxoacyl-[acyl-carrier protein] reductase
FT                   fabG SWALL:FABG_VIBHA (SWALL:P55336) (244 aa) fasta scores:
FT                   E(): 5.3e-43, 53.9% id in 243 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB472"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63925"
FT                   /db_xref="GOA:Q5L606"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L606"
FT                   /protein_id="CAH63925.1"
FT                   /translation="MNGILSGKKAIVTGGSRGIGFAISKLFVEQGADVEIWGINDEGGK
FT                   QAAQELSKIGRPATFAKVDVSKSQSVKDAVQNFITAHGNIDILVNNAGITRDNLLMRMS
FT                   EEEWSAVINTNLNSLYYVCSSVIRPMIKARSGSIINISSVVGLMGSPGQTNYAAAKAGI
FT                   IGFSRALAKEVAARNIRVNCIAPGCIDTDMTRVLNDNLKTEWLKNVPMGRMGFPEEIAN
FT                   AALFLASPLSSYITSQVLSVDGGMTY"
     MNGILSGKKA IVTGGSRGIG FAISKLFVEQ GADVEIWGIN DEGGKQAAQE LSKIGRPATF        60
     AKVDVSKSQS VKDAVQNFIT AHGNIDILVN NAGITRDNLL MRMSEEEWSA VINTNLNSLY       120
     YVCSSVIRPM IKARSGSIIN ISSVVGLMGS PGQTNYAAAK AGIIGFSRAL AKEVAARNIR       180
     VNCIAPGCID TDMTRVLNDN LKTEWLKNVP MGRMGFPEEI ANAALFLASP LSSYITSQVL       240
     SVDGGMTY                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page