(data stored in SCRATCH zone)

EMBL: CR848038.FABZ

CR848038.FABZ        Location/Qualifiers
FT   CDS             104682..105146
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="CAB089"
FT                   /product="(3r)-hydroxymyristoyl-[acyl carrier protein]
FT                   dehydratase"
FT                   /note="Similar to Chlamydia pneumoniae FabZ or cpn0651 or
FT                   cp0096 SWALL:FABZ_CHLPN (SWALL:Q9Z7Q3) (153 aa) fasta
FT                   scores: E(): 6.8e-47, 81.69% id in 153 aa, and to
FT                   Escherichia coli, and Escherichia coli O157:H7 FabZ or SefA
FT                   SWALL:FABZ_ECOLI (SWALL:P21774) (151 aa) fasta scores: E():
FT                   1.6e-17, 42.85% id in 140 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB089"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63546"
FT                   /db_xref="GOA:Q5L724"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L724"
FT                   /protein_id="CAH63546.1"
FT                   /translation="MKESPVIKLRELLNLLPHRYPFLLVDKVLSYDLERRSIVAQKNVT
FT                   INEPFFVGHFPEAPIMPGVLILESLAQAAGVLLGLVLENDRNKRLALFLGIHKAKFRQA
FT                   VKPGDILTLSAEFSLISSKGGKASARACVGSQVAAEGELSFALVDKKSLD"
     MKESPVIKLR ELLNLLPHRY PFLLVDKVLS YDLERRSIVA QKNVTINEPF FVGHFPEAPI        60
     MPGVLILESL AQAAGVLLGL VLENDRNKRL ALFLGIHKAK FRQAVKPGDI LTLSAEFSLI       120
     SSKGGKASAR ACVGSQVAAE GELSFALVDK KSLD                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page