(data stored in SCRATCH zone)

EMBL: CR848038.IHFA

CR848038.IHFA        Location/Qualifiers
FT   CDS             421924..422226
FT                   /transl_table=11
FT                   /gene="ihfA"
FT                   /locus_tag="CAB365"
FT                   /product="integration host factor alpha-subunit"
FT                   /note="Similar to many including: Haemophilus influenzae
FT                   integration host factor alpha-subunit IhfA or HimA or
FT                   Hi1313 SWALL:IHFA_HAEIN (SWALL:P43723) (96 aa) fasta
FT                   scores: E(): 1.7e-06, 30.85% id in 94 aa and to Chlamydia
FT                   pneumoniae probable DNA-binding protein HU Hup or cpn0416
FT                   or cp0338 SWALL:DBH_CHLPN (SWALL:Q9Z8C7) (100 aa) fasta
FT                   scores: E(): 2.7e-36, 98% id in 100 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB365"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63818"
FT                   /db_xref="GOA:Q5L6B0"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6B0"
FT                   /protein_id="CAH63818.1"
FT                   /translation="MATMTKKKLISTISQDHKIHPNHVRTVIQNFLDKMTDALVKGDRL
FT                   EFRDFGVLQVVERKPKVGRNPKNATVPIHIPARRAVKFTPGKRMKRLIETPSKHS"
     MATMTKKKLI STISQDHKIH PNHVRTVIQN FLDKMTDALV KGDRLEFRDF GVLQVVERKP        60
     KVGRNPKNAT VPIHIPARRA VKFTPGKRMK RLIETPSKHS                             100
//

If you have problems or comments...

PBIL Back to PBIL home page