(data stored in SCRATCH zone)

EMBL: CR848038.INFB

CR848038.INFB        Location/Qualifiers
FT   CDS             complement(517852..520476)
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="CAB451"
FT                   /product="translation initiation factor"
FT                   /note="Similar to many translation initiation factors
FT                   including: Neisseria meningitidis translation initiation
FT                   factor If-2 Infb or Nma1897 SWALL:IF2_NEIMA (SWALL:Q9JTB5)
FT                   (962 aa) fasta scores: E(): 5.9e-73, 35.5% id in 904 aa and
FT                   Listeria monocytogenes translation initiation factor If-2
FT                   Infb or lmo1325 SWALL:IF2_LISMO (SWALL:Q8Y7F6) (779 aa)
FT                   fasta scores: E(): 9.6e-74, 39.39% id in 731 aa. Note the
FT                   overlap with the upstream CDS"
FT                   /db_xref="EnsemblGenomes-Gn:CAB451"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63904"
FT                   /db_xref="GOA:Q5L627"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L627"
FT                   /protein_id="CAH63904.1"
FT                   /translation="MKIKNAQLTKAAGLDKLKQKLAQAGSSDTKSSSEKPTTKVPEKVA
FT                   KEKVVKKKSVLDSSVPTMAEHVSTETSPRRIRAKNRSSFASEDSTIPSPVSVDTESTAF
FT                   SPPVVEEVVSPLESAEPEIVEPTPASIVDEPETTIQEPPPPKKEAELVVKKEPPKNVVS
FT                   IKSNFGPTGKHINHLLAKTFKAPKKEDKPAPKERTGTVQTKPQQSSEVPSDKQHSSNNR
FT                   QSQPFYRRDTSKRPGSDFRDRSKKDDSPKAFTGRDRYGLNDSSDDDKWRKKRVQKTKKH
FT                   YDEHSVQRPTHIKVPLPITIKDLAAEMKLKASELIQKMFIHGMTYVVNDVLDNETTVQF
FT                   IGLEFGCTIDIDSSEQDKLCIESNTVKEEIQETDPSQLIIRPPIVAFMGHVDHGKTTLI
FT                   DSLRKSNVAAVEAGAITQHMGAFCCSTPVGNITILDTPGHEAFSAMRARGAEVCDIVVL
FT                   VVAGDEGIKEQTLEAVKHARAANITIVVAINKCDKPNFNADTVYRQLSEINLLPEAWGG
FT                   TTVTINTSAKTGEGLSELLEMLALQAEVLELKANPEARARGIVIESELHKGLGAVATIL
FT                   VQNGTLHLGEALVFNDCYGKVKTMHNEHNQLMTSASPSVPALITGLSSMPKAGDPFVVV
FT                   KNEKTAKEIVNARIAGQQKFALQKKRPNFDAMLQNKKILKLIIKADVQGSIEALSSSVL
FT                   KIVSDKVSAEILSSSVGEISESDIRLAAASKAVIIGFHTGIESHAESLIKNLGVKVHLF
FT                   NIIYHAVDAVKEMMTALLDPIAEERNLGSAEIKETFKSSQLGTIYGCLVSEGVMTRNQK
FT                   VRVVRNNEVLWKGNLSSLKRIKEDVKEVKKGLECGILLEGYQNAQVGDILQCYEVIYHP
FT                   QKL"
     MKIKNAQLTK AAGLDKLKQK LAQAGSSDTK SSSEKPTTKV PEKVAKEKVV KKKSVLDSSV        60
     PTMAEHVSTE TSPRRIRAKN RSSFASEDST IPSPVSVDTE STAFSPPVVE EVVSPLESAE       120
     PEIVEPTPAS IVDEPETTIQ EPPPPKKEAE LVVKKEPPKN VVSIKSNFGP TGKHINHLLA       180
     KTFKAPKKED KPAPKERTGT VQTKPQQSSE VPSDKQHSSN NRQSQPFYRR DTSKRPGSDF       240
     RDRSKKDDSP KAFTGRDRYG LNDSSDDDKW RKKRVQKTKK HYDEHSVQRP THIKVPLPIT       300
     IKDLAAEMKL KASELIQKMF IHGMTYVVND VLDNETTVQF IGLEFGCTID IDSSEQDKLC       360
     IESNTVKEEI QETDPSQLII RPPIVAFMGH VDHGKTTLID SLRKSNVAAV EAGAITQHMG       420
     AFCCSTPVGN ITILDTPGHE AFSAMRARGA EVCDIVVLVV AGDEGIKEQT LEAVKHARAA       480
     NITIVVAINK CDKPNFNADT VYRQLSEINL LPEAWGGTTV TINTSAKTGE GLSELLEMLA       540
     LQAEVLELKA NPEARARGIV IESELHKGLG AVATILVQNG TLHLGEALVF NDCYGKVKTM       600
     HNEHNQLMTS ASPSVPALIT GLSSMPKAGD PFVVVKNEKT AKEIVNARIA GQQKFALQKK       660
     RPNFDAMLQN KKILKLIIKA DVQGSIEALS SSVLKIVSDK VSAEILSSSV GEISESDIRL       720
     AAASKAVIIG FHTGIESHAE SLIKNLGVKV HLFNIIYHAV DAVKEMMTAL LDPIAEERNL       780
     GSAEIKETFK SSQLGTIYGC LVSEGVMTRN QKVRVVRNNE VLWKGNLSSL KRIKEDVKEV       840
     KKGLECGILL EGYQNAQVGD ILQCYEVIYH PQKL                                   874
//

If you have problems or comments...

PBIL Back to PBIL home page