(data stored in SCRATCH zone)

EMBL: CR848038.LPXD

CR848038.LPXD        Location/Qualifiers
FT   CDS             complement(538065..539144)
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /locus_tag="CAB466"
FT                   /product="UDP-3-o-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="Similar to Escherichia coli
FT                   UDP-3-o-[3-hydroxymyristoyl] glucosamine N-acyltransferase
FT                   LpxD SWALL:LPXD_ECOLI (SWALL:P21645) (340 aa) fasta scores:
FT                   E(): 1.1e-32, 33.92% id in 339 aa, and to Pseudomonas
FT                   aeruginosa UDP-3-o-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase LpxD or pa3646 SWALL:LPXD_PSEAE
FT                   (SWALL:Q9HXY6) (353 aa) fasta scores: E(): 4.3e-41, 39.31%
FT                   id in 351 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB466"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63919"
FT                   /db_xref="GOA:Q5L612"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L612"
FT                   /protein_id="CAH63919.1"
FT                   /translation="MPQELVYTLQQLADLLKVEVQGNTETPISGVEEISAAKAHHVTFL
FT                   DNEKYARFIKITEAGAIILSKAQAQKYGHLNKNFLIVSEFPSIAFQKCIELFISPVDSG
FT                   FPGIHPTAVIHPTASIGKDVCIEPYAVICQHACIGDSTYIGTGSVIGAYSTLGEHCLVH
FT                   PKVVVRERVEIGKRVIIQPGAVIGSCGFGYITNAFGRHKHLKHLGKVIIEDDVEIGANT
FT                   TIDRGRFKNSVIREGTKIDNQVQIAHHVEVGKHSMIVAQAGIAGSTKIGNHVIIGGQTG
FT                   ITGHISITDHVIMMAQTGVTKSISSPGIYGGAPARPYQEIHRQVAKIRSLPKLEERLGM
FT                   LEEKVKGLSAQSTELQITP"
     MPQELVYTLQ QLADLLKVEV QGNTETPISG VEEISAAKAH HVTFLDNEKY ARFIKITEAG        60
     AIILSKAQAQ KYGHLNKNFL IVSEFPSIAF QKCIELFISP VDSGFPGIHP TAVIHPTASI       120
     GKDVCIEPYA VICQHACIGD STYIGTGSVI GAYSTLGEHC LVHPKVVVRE RVEIGKRVII       180
     QPGAVIGSCG FGYITNAFGR HKHLKHLGKV IIEDDVEIGA NTTIDRGRFK NSVIREGTKI       240
     DNQVQIAHHV EVGKHSMIVA QAGIAGSTKI GNHVIIGGQT GITGHISITD HVIMMAQTGV       300
     TKSISSPGIY GGAPARPYQE IHRQVAKIRS LPKLEERLGM LEEKVKGLSA QSTELQITP        359
//

If you have problems or comments...

PBIL Back to PBIL home page