(data stored in SCRATCH zone)

EMBL: CR848038.NDK

CR848038.NDK         Location/Qualifiers
FT   CDS             125197..125622
FT                   /transl_table=11
FT                   /gene="ndk"
FT                   /locus_tag="CAB120"
FT                   /product="putative nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /note="Similar to Chlamydia trachomatis nucleoside
FT                   diphosphate kinase Ndk or ct500 SWALL:NDK_CHLTR
FT                   (SWALL:O84508) (141 aa) fasta scores: E(): 4.2e-45, 87.23%
FT                   id in 141 aa, and to Escherichia coli, and Escherichia coli
FT                   O157:H7 nucleoside diphosphate kinase Ndk SWALL:NDK_ECOLI
FT                   (SWALL:P24233) (142 aa) fasta scores: E(): 1.9e-26, 56.61%
FT                   id in 136 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB120"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63578"
FT                   /db_xref="GOA:Q5L6Z2"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L6Z2"
FT                   /protein_id="CAH63578.1"
FT                   /translation="MEQTLSIIKPDSVGKAHIGEIIAIFEKSGFRIAAMKMLHLSVKEA
FT                   EGFYAVHKSRPFFQELVDFMISGPVVVMVLEGNNAVARNREIMGATNPQEAAPGTIRAQ
FT                   FGESIGINAVHGSDSLENAAIEINYFFSKVEIVNSAA"
     MEQTLSIIKP DSVGKAHIGE IIAIFEKSGF RIAAMKMLHL SVKEAEGFYA VHKSRPFFQE        60
     LVDFMISGPV VVMVLEGNNA VARNREIMGA TNPQEAAPGT IRAQFGESIG INAVHGSDSL       120
     ENAAIEINYF FSKVEIVNSA A                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page