(data stored in SCRATCH zone)

EMBL: CR848038.PE12

CR848038.PE12        Location/Qualifiers
FT   CDS             complement(17729..18598)
FT                   /transl_table=11
FT                   /locus_tag="CAB012"
FT                   /product="putative endonuclease IV"
FT                   /EC_number="3.1.21.2"
FT                   /note="Similar to Chlamydia pneumoniae probable
FT                   endonuclease IV cpn0732 or cp0014 SWALL:END4_CHLPN
FT                   (SWALL:Q9Z7H3) (293 aa) fasta scores: E(): 3.3e-91, 74.04%
FT                   id in 289 aa, and to Escherichia coli, and Escherichia coli
FT                   O157:H7 endonuclease IV Nfo SWALL:END4_ECOLI (SWALL:P12638)
FT                   (285 aa) fasta scores: E(): 1.2e-42, 43.21% id in 280 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB012"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63470"
FT                   /db_xref="GOA:Q5L798"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L798"
FT                   /protein_id="CAH63470.1"
FT                   /translation="MQVFPPPQVPLLGAHTSTSGGLQNAIYEGQEIGASTVQMFTANQR
FT                   QWRRRPLTDDLINSFKTALEETSLSYIMSHAGYLINPGAPNPEILEKSRICIQQEIQDC
FT                   LSLGITFVNFHPGAAVNDTKEACLDRIVSSFSLVEPLFEDSPPLVVLFETTAGQGTLVG
FT                   STFEELGYLIDKLKHKIPVGVCIDTCHIFASGYDITSPGSWKQVLKNFDDAIGLSYLRA
FT                   FHLNDSMFPLGKHKDRHAPLGEGDIGMESFKFLMTDELTRMIPKYLETPGGPDLWTKEI
FT                   RQLKSFQK"
     MQVFPPPQVP LLGAHTSTSG GLQNAIYEGQ EIGASTVQMF TANQRQWRRR PLTDDLINSF        60
     KTALEETSLS YIMSHAGYLI NPGAPNPEIL EKSRICIQQE IQDCLSLGIT FVNFHPGAAV       120
     NDTKEACLDR IVSSFSLVEP LFEDSPPLVV LFETTAGQGT LVGSTFEELG YLIDKLKHKI       180
     PVGVCIDTCH IFASGYDITS PGSWKQVLKN FDDAIGLSYL RAFHLNDSMF PLGKHKDRHA       240
     PLGEGDIGME SFKFLMTDEL TRMIPKYLET PGGPDLWTKE IRQLKSFQK                   289
//

If you have problems or comments...

PBIL Back to PBIL home page