(data stored in SCRATCH zone)

EMBL: CR848038.PE13

CR848038.PE13        Location/Qualifiers
FT   CDS             18664..20307
FT                   /transl_table=11
FT                   /locus_tag="CAB013"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Chlamydia muridarum virulence factor MviN
FT                   homologue or tc0913 SWALL:MVIN_CHLMU (SWALL:Q9PJB9) (536
FT                   aa) fasta scores: E(): 1.6e-153, 72.6% id in 533 aa. The
FT                   Chlamydia trachomatis orthologue of this gene is expressed
FT                   during natural infection."
FT                   /db_xref="EnsemblGenomes-Gn:CAB013"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63471"
FT                   /db_xref="GOA:Q5L797"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L797"
FT                   /protein_id="CAH63471.1"
FT                   /translation="MNKKDGQGSVASSLFNLLSGTFFSRVTGMLREIVMAAYFGADPLV
FT                   AAFWLAFRTIFFLRKILGGPVLGLAFIPHFEFLRAQDTSRAAFFFKSFSRFFCYNACAF
FT                   TLIIEIGLGFWLYHAQGNLADALLLTMILLPSGIFLMMYTVNSALLHCEKRFLSVGLAP
FT                   AVVNVLWILTVFLARHSDPRQRIIGLSVVLVIGFVLEWSVTLPGVNKFLGTATTPPKER
FT                   DSIKALIAPLSLGLLSMGVFQINLLTDMCLARYIHEVGPLYLMYSIRIQQLPVHLFGLG
FT                   VFTVLLPSISRCVQEDNNEAGYELMKFALNLTVSVMVIMTVGLLLLALPGVRVLYEHGL
FT                   FPTSAVHAIVQVLRGYSGSIIPMALIPLISVLFYAQRHYTIPLVIGIFAAIANMVLNVI
FT                   FGCWLIKHVSGLAYATSLVSWVQLYFLWQCASKKHLAYSGLMWITFKRSIKVVGVTSLA
FT                   FVVTLGTNILTHTTYVVFLEPYTPLAWSLSSFVAQSAAFFSESVIFLAFLFGFAKLLRV
FT                   EDLVNLTSFQYWKGRRSSLLSSSVVQDSQN"
     MNKKDGQGSV ASSLFNLLSG TFFSRVTGML REIVMAAYFG ADPLVAAFWL AFRTIFFLRK        60
     ILGGPVLGLA FIPHFEFLRA QDTSRAAFFF KSFSRFFCYN ACAFTLIIEI GLGFWLYHAQ       120
     GNLADALLLT MILLPSGIFL MMYTVNSALL HCEKRFLSVG LAPAVVNVLW ILTVFLARHS       180
     DPRQRIIGLS VVLVIGFVLE WSVTLPGVNK FLGTATTPPK ERDSIKALIA PLSLGLLSMG       240
     VFQINLLTDM CLARYIHEVG PLYLMYSIRI QQLPVHLFGL GVFTVLLPSI SRCVQEDNNE       300
     AGYELMKFAL NLTVSVMVIM TVGLLLLALP GVRVLYEHGL FPTSAVHAIV QVLRGYSGSI       360
     IPMALIPLIS VLFYAQRHYT IPLVIGIFAA IANMVLNVIF GCWLIKHVSG LAYATSLVSW       420
     VQLYFLWQCA SKKHLAYSGL MWITFKRSIK VVGVTSLAFV VTLGTNILTH TTYVVFLEPY       480
     TPLAWSLSSF VAQSAAFFSE SVIFLAFLFG FAKLLRVEDL VNLTSFQYWK GRRSSLLSSS       540
     VVQDSQN                                                                 547
//

If you have problems or comments...

PBIL Back to PBIL home page