(data stored in SCRATCH zone)

EMBL: CR848038.PE141

CR848038.PE141       Location/Qualifiers
FT   CDS             150758..152227
FT                   /transl_table=11
FT                   /locus_tag="CAB141"
FT                   /product="putative transport protein"
FT                   /note="Similar to Chlamydia pneumoniae oligopeptide
FT                   permease OppB_2 or cpn0598 or cp0150 SWALL:Q9Z7V6
FT                   (EMBL:AE001644) (493 aa) fasta scores: E(): 3.8e-147,
FT                   71.66% id in 494 aa, and to Escherichia coli, and
FT                   Escherichia coli O157:H7 dipeptide transport system
FT                   permease protein DppB SWALL:DPPB_ECOLI (SWALL:P37316) (339
FT                   aa) fasta scores: E(): 1.3e-17, 29.13% id in 278 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB141"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63599"
FT                   /db_xref="GOA:Q5L6X1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6X1"
FT                   /protein_id="CAH63599.1"
FT                   /translation="MLKYILKRLILIPLTLFAIISINFIILNAAPGDVIEEQSVDAFGD
FT                   PGKSDKIRTYKGPDRYLQFREHYGLTLPIFFNTRPAISHAKVKSGIEEIVDCFIKKQSF
FT                   SKLKIYWGDRAKFLLPVLLFEANDNTKTPSYRHVAADLFIRGAIRQGIVGSGLSPEQYA
FT                   YNERVSKSNAMLVKLLSEEDIGIKVDSLKEWFRQEGGMEAFPYRHFSWKTFFLETRFAR
FT                   YMSRVLRLDFGTLRNDPHKTVVSEVVKRLRSSLTLSVFPMILVFILCQVFGMLMALNRN
FT                   RWIDHTLNFIFLFLFSVPVFVAVPWIIDNFVINKTIPFTSIPMPYSGLQSSPEIFNQLS
FT                   SWGKILDTLAHSFLPFCAVSYGAFASQSRLSRSVFLEILGEDYICAARARGVSRYDILV
FT                   KHVGKNAASSLITSLASSLGAILGGALVVETLFDIDGFGRFFYQAILNRDHNVVLFSVL
FT                   VGSALSLLGYLIGDICYVLLDPRVQLGGKRV"
     MLKYILKRLI LIPLTLFAII SINFIILNAA PGDVIEEQSV DAFGDPGKSD KIRTYKGPDR        60
     YLQFREHYGL TLPIFFNTRP AISHAKVKSG IEEIVDCFIK KQSFSKLKIY WGDRAKFLLP       120
     VLLFEANDNT KTPSYRHVAA DLFIRGAIRQ GIVGSGLSPE QYAYNERVSK SNAMLVKLLS       180
     EEDIGIKVDS LKEWFRQEGG MEAFPYRHFS WKTFFLETRF ARYMSRVLRL DFGTLRNDPH       240
     KTVVSEVVKR LRSSLTLSVF PMILVFILCQ VFGMLMALNR NRWIDHTLNF IFLFLFSVPV       300
     FVAVPWIIDN FVINKTIPFT SIPMPYSGLQ SSPEIFNQLS SWGKILDTLA HSFLPFCAVS       360
     YGAFASQSRL SRSVFLEILG EDYICAARAR GVSRYDILVK HVGKNAASSL ITSLASSLGA       420
     ILGGALVVET LFDIDGFGRF FYQAILNRDH NVVLFSVLVG SALSLLGYLI GDICYVLLDP       480
     RVQLGGKRV                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page