(data stored in SCRATCH zone)

EMBL: CR848038.PE146

CR848038.PE146       Location/Qualifiers
FT   CDS             157958..159043
FT                   /transl_table=11
FT                   /locus_tag="CAB146"
FT                   /product="putative exported protein"
FT                   /note="Similar to Chlamydia pneumoniae hypothetical protein
FT                   cpn0593/cp0155/cpj0593 cpn0593 or cp0155 or cpj0593
FT                   SWALL:Y593_CHLPN (SWALL:Q9Z7W1) (362 aa) fasta scores: E():
FT                   1.9e-78, 54.27% id in 363 aa. Only significant database
FT                   matches are to predicted Chlamydiaceae proteins."
FT                   /db_xref="EnsemblGenomes-Gn:CAB146"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63604"
FT                   /db_xref="GOA:Q5L6W6"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6W6"
FT                   /protein_id="CAH63604.1"
FT                   /translation="MTWRKTIRWLKQALVLSAVLNIVFLLLFYSTIFRKDIYKLRLFSG
FT                   PLVAKNCRVQKIPEDFLERLSEASLEELYRLLDEDHLLYGRPLKLWALSVAIHAYDVDV
FT                   GGALSHPLTFTQLRSQGKTWLLPNIDEKEYGLVRRYLSRERYPFTTRGLFRAISTHLEQ
FT                   GAVDEDCLYHFCHTPEFLYFRTLLCGAEERVSSVASLARMVIHNGEAMFFSLCNENHRA
FT                   TAISPEQRQKVLLTYTSVGEPLAALLLLVYDADWVLHTFTDEDLKTFVALLPKESPYTQ
FT                   DFIHRIVETPRSFIVEAEKAEACVTEEPIVYEDYVVKEGDSLWLIARRFGVTIEDIMRV
FT                   NHLSHHRLLPGKHLKLPPKSS"
     MTWRKTIRWL KQALVLSAVL NIVFLLLFYS TIFRKDIYKL RLFSGPLVAK NCRVQKIPED        60
     FLERLSEASL EELYRLLDED HLLYGRPLKL WALSVAIHAY DVDVGGALSH PLTFTQLRSQ       120
     GKTWLLPNID EKEYGLVRRY LSRERYPFTT RGLFRAISTH LEQGAVDEDC LYHFCHTPEF       180
     LYFRTLLCGA EERVSSVASL ARMVIHNGEA MFFSLCNENH RATAISPEQR QKVLLTYTSV       240
     GEPLAALLLL VYDADWVLHT FTDEDLKTFV ALLPKESPYT QDFIHRIVET PRSFIVEAEK       300
     AEACVTEEPI VYEDYVVKEG DSLWLIARRF GVTIEDIMRV NHLSHHRLLP GKHLKLPPKS       360
     S                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page