(data stored in SCRATCH zone)

EMBL: CR848038.PE149

CR848038.PE149       Location/Qualifiers
FT   CDS             160344..160934
FT                   /transl_table=11
FT                   /locus_tag="CAB149"
FT                   /product="putative lipoprotein"
FT                   /note="Similar to Chlamydia muridarum hypothetical protein
FT                   Tc0756 tc0756 SWALL:Q9PJS2 (EMBL:AE002343) (209 aa) fasta
FT                   scores: E(): 5.4e-47, 58.11% id in 191 aa. Only significant
FT                   database matches are to predicted Chlamydiaceae proteins."
FT                   /db_xref="EnsemblGenomes-Gn:CAB149"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63607"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6W3"
FT                   /protein_id="CAH63607.1"
FT                   /translation="MRFLSIFLFVFSFITSCSLPVCSEHYISEDEKFHIDRFNFSGEFP
FT                   DMETMEIHAQRKKRVHFDVSGDFPKLESIVYNGSFGFLRAKLTGRYPKLTSLMISCSSC
FT                   KMDLDFRGKWERNATISLSNEVEPLTLTLPKNVGVIVHTKVSTKGKVVLEGDFEKRGRG
FT                   IWRKTYHNSLVGIAPVTLVFEVQSSSGGTITLR"
     MRFLSIFLFV FSFITSCSLP VCSEHYISED EKFHIDRFNF SGEFPDMETM EIHAQRKKRV        60
     HFDVSGDFPK LESIVYNGSF GFLRAKLTGR YPKLTSLMIS CSSCKMDLDF RGKWERNATI       120
     SLSNEVEPLT LTLPKNVGVI VHTKVSTKGK VVLEGDFEKR GRGIWRKTYH NSLVGIAPVT       180
     LVFEVQSSSG GTITLR                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page