(data stored in SCRATCH zone)

EMBL: CR848038.PE15

CR848038.PE15        Location/Qualifiers
FT   CDS             21806..23725
FT                   /transl_table=11
FT                   /locus_tag="CAB015"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Chlamydia pneumoniae Chlpn 76 kDa
FT                   homolog_1 cpn0728 or cpj0728 or cp0018 SWALL:Q9Z7H7
FT                   (EMBL:AE001654) (651 aa) fasta scores: E(): 1.3e-66, 43.43%
FT                   id in 663 aa, and to Chlamydia pneumoniae 76 kDa protein
FT                   SWALL:Q46166 (EMBL:L23921) (715 aa) fasta scores: E():
FT                   2.5e-28, 36.44% id in 461 aa. Similar to CAB014. Only
FT                   significant full-length database matches are to
FT                   Chlamydiaceae proteins."
FT                   /db_xref="EnsemblGenomes-Gn:CAB015"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63473"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L795"
FT                   /protein_id="CAH63473.1"
FT                   /translation="MVNPVGPIDESKNIAPADLSTLGMQASAANRSAEAESIAEVEGKN
FT                   GSPRPSVNTLGRLSFLSSARNALINFFNKISALFTGKSVPKDFEEAKTQASNAQNALKT
FT                   AKTFDEFKTALQQLQDAIKYMEQFAETDEQKTEVATLKAALAEKQPIIDTINKLGGILE
FT                   ENEKLLEAIKTTSSIDQITGVAGQVEVNKAAAAALIEELKKLGVTADSYPVIGDTETKI
FT                   NTSSTEITKVAEAINSAYTAGKNSTTAVGQAQANNSPANIEASKNTIKEAKSTIDAALG
FT                   LAPDSPIVKAAQKEQQKAVKDIDKIKPSGGSDVPIGGPGAPGSVGTSQNRGTTVGEARI
FT                   SMLLADVDNETAAIIMQGFRNMIDNFHTQNPDITAPLEEVLAQVTDLTTQANPADAEAT
FT                   TQLQEIQQTLQEALQGISGEEGLTNALGAITTAASISTGAPIASANQGGSAVKQLYKTS
FT                   SASASSKSYVDTLSAGYGAYQSLNDVYSRSSAANREVLDRTSTPALTRTVSRTETQPRD
FT                   NDTAAQRFARTIAGNSHTLGDVYASVNVLQTLLGVLQSNPQANEDEIKQKLTSAITKAP
FT                   QSGYPYVQLSNDATQKFIAKLEDEFARGSKRLAEAKEAAFEKQPLFIQQVLVNVASLFS
FT                   GYLQ"
     MVNPVGPIDE SKNIAPADLS TLGMQASAAN RSAEAESIAE VEGKNGSPRP SVNTLGRLSF        60
     LSSARNALIN FFNKISALFT GKSVPKDFEE AKTQASNAQN ALKTAKTFDE FKTALQQLQD       120
     AIKYMEQFAE TDEQKTEVAT LKAALAEKQP IIDTINKLGG ILEENEKLLE AIKTTSSIDQ       180
     ITGVAGQVEV NKAAAAALIE ELKKLGVTAD SYPVIGDTET KINTSSTEIT KVAEAINSAY       240
     TAGKNSTTAV GQAQANNSPA NIEASKNTIK EAKSTIDAAL GLAPDSPIVK AAQKEQQKAV       300
     KDIDKIKPSG GSDVPIGGPG APGSVGTSQN RGTTVGEARI SMLLADVDNE TAAIIMQGFR       360
     NMIDNFHTQN PDITAPLEEV LAQVTDLTTQ ANPADAEATT QLQEIQQTLQ EALQGISGEE       420
     GLTNALGAIT TAASISTGAP IASANQGGSA VKQLYKTSSA SASSKSYVDT LSAGYGAYQS       480
     LNDVYSRSSA ANREVLDRTS TPALTRTVSR TETQPRDNDT AAQRFARTIA GNSHTLGDVY       540
     ASVNVLQTLL GVLQSNPQAN EDEIKQKLTS AITKAPQSGY PYVQLSNDAT QKFIAKLEDE       600
     FARGSKRLAE AKEAAFEKQP LFIQQVLVNV ASLFSGYLQ                              639
//

If you have problems or comments...

PBIL Back to PBIL home page