(data stored in SCRATCH zone)

EMBL: CR848038.PE185

CR848038.PE185       Location/Qualifiers
FT   CDS             203965..204915
FT                   /transl_table=11
FT                   /locus_tag="CAB185"
FT                   /product="putative exported protein"
FT                   /note="Similar to Chlamydia pneumoniae hypothetical protein
FT                   cpn0553 cpn0553 or cpj0553 or cp0199 SWALL:Q9Z7Z9
FT                   (EMBL:AE001639) (312 aa) fasta scores: E(): 1.2e-44, 41.39%
FT                   id in 302 aa."
FT                   /db_xref="EnsemblGenomes-Gn:CAB185"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63643"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6S8"
FT                   /protein_id="CAH63643.1"
FT                   /translation="MYYLCFFILITSFLTGHASPVASSEVFPWIAPKSLTVLGSPFIDV
FT                   ILETPKEFIEKCDVKVGEIQNINSSDIKKIFLMYRETFPENPITVTRKEPLSLTEDQLA
FT                   NLGCISLLNKPPYLHYGKQAEYGPALQAWDHLRLILRCPNQEDTFCYFLEETPKSLAEL
FT                   SLSSDVGYTLIDSDLLIYGCYIESFLKKARGPNHKILFDLNNPHIVQHYRDRVWSLLPY
FT                   IDVLFLSEESTKSLTGMSNASLGRRLLSHMIPTVFVQNTAEEKAQIYFIQHGKETVYSA
FT                   TQELQQIVLAFLFGYIHDNVIDYCFHAGDLLLEYA"
     MYYLCFFILI TSFLTGHASP VASSEVFPWI APKSLTVLGS PFIDVILETP KEFIEKCDVK        60
     VGEIQNINSS DIKKIFLMYR ETFPENPITV TRKEPLSLTE DQLANLGCIS LLNKPPYLHY       120
     GKQAEYGPAL QAWDHLRLIL RCPNQEDTFC YFLEETPKSL AELSLSSDVG YTLIDSDLLI       180
     YGCYIESFLK KARGPNHKIL FDLNNPHIVQ HYRDRVWSLL PYIDVLFLSE ESTKSLTGMS       240
     NASLGRRLLS HMIPTVFVQN TAEEKAQIYF IQHGKETVYS ATQELQQIVL AFLFGYIHDN       300
     VIDYCFHAGD LLLEYA                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page