(data stored in SCRATCH zone)

EMBL: CR848038.PE190

CR848038.PE190       Location/Qualifiers
FT   CDS             208468..209517
FT                   /transl_table=11
FT                   /locus_tag="CAB190"
FT                   /product="putative oxidoreductase"
FT                   /note="Similar to Chlamydia pneumoniae sulfite reductase
FT                   CysJ or cpn0548 or cp0204 SWALL:Q9Z804 (EMBL:AE001639) (347
FT                   aa) fasta scores: E(): 9.2e-79, 56.85% id in 350 aa, and to
FT                   Escherichia coli sulfite reductase [NADPH] flavoprotein
FT                   alpha-component CysJ or b2764 SWALL:CYSJ_ECOLI
FT                   (SWALL:P38038) (598 aa) fasta scores: E(): 2e-19, 30.34% id
FT                   in 346 aa, and to Physarum polycephalum nitric oxide
FT                   synthase form b NosB SWALL:Q968Y5 (EMBL:AF145040) (1046 aa)
FT                   fasta scores: E(): 3.1e-19, 29.85% id in 355 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB190"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63648"
FT                   /db_xref="GOA:Q5L6S3"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6S3"
FT                   /protein_id="CAH63648.1"
FT                   /translation="MHLLEKFKAQRVSLLSRELISCCDPAIASSDAGHVYQLLFNTTGS
FT                   NLSYKVGDSLGVFPKNPVHVVEKILECLSYSPKQLVQSRESSQISLYDFLRCHTNINKV
FT                   PPKLKSFFPDLEETMTFYDAIQKYQPHIPVELFVESVLPLLPRFYSIASAPHPHENQIE
FT                   LLVRLVNYSGEYEQRYGVCSFFLCRELELGKSCHVFVQPTKHFTLAEHVQNQPIVMIGS
FT                   GTGIAPYKAFVQQRIYNNDSGMNILFFGERFEKANFYYQDFWKKAVENELLKLFLAFSR
FT                   DGDRKLYVQDLLKQHADLVLKAYQKGAYFFVCGSKVLGNEVKKTLEDILGKNKLSQLKE
FT                   EHRYVADVY"
     MHLLEKFKAQ RVSLLSRELI SCCDPAIASS DAGHVYQLLF NTTGSNLSYK VGDSLGVFPK        60
     NPVHVVEKIL ECLSYSPKQL VQSRESSQIS LYDFLRCHTN INKVPPKLKS FFPDLEETMT       120
     FYDAIQKYQP HIPVELFVES VLPLLPRFYS IASAPHPHEN QIELLVRLVN YSGEYEQRYG       180
     VCSFFLCREL ELGKSCHVFV QPTKHFTLAE HVQNQPIVMI GSGTGIAPYK AFVQQRIYNN       240
     DSGMNILFFG ERFEKANFYY QDFWKKAVEN ELLKLFLAFS RDGDRKLYVQ DLLKQHADLV       300
     LKAYQKGAYF FVCGSKVLGN EVKKTLEDIL GKNKLSQLKE EHRYVADVY                   349
//

If you have problems or comments...

PBIL Back to PBIL home page