(data stored in SCRATCH zone)

EMBL: CR848038.PE195

CR848038.PE195       Location/Qualifiers
FT   CDS             complement(212689..213582)
FT                   /transl_table=11
FT                   /locus_tag="CAB195"
FT                   /product="putative transport protein"
FT                   /note="Similar to Chlamydia pneumoniae probable metal
FT                   transport system membrane protein cpn0543 or cp0209 or
FT                   cpj0543 SWALL:Y543_CHLPN (SWALL:Q9Z809) (293 aa) fasta
FT                   scores: E(): 1.9e-82, 78.21% id in 280 aa, and to Listeria
FT                   monocytogenes hydrophobic membrane protein ZurM
FT                   SWALL:Q9XDA5 (EMBL:AF104349) (295 aa) fasta scores: E():
FT                   2.6e-17, 23.77% id in 265 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB195"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63653"
FT                   /db_xref="GOA:Q5L6R8"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6R8"
FT                   /protein_id="CAH63653.1"
FT                   /translation="MISFFNHILPSLLLPSLLAALGASIAGGVVGTYIVVKRIVSISGS
FT                   ISHSILGGIGLTLWIQYRLNIEFPPMYGAIIGAIILALCIGKIHLKYQEREDALIAMIW
FT                   SVGMAIGIIFISQLPAFNSELVNFLFGNILWVTTSDLFRLGILDVIVLTMVALCHTRFL
FT                   SLCFDEKYMMLSRYSVQTWYFLLVILAAITIVMLIYIMGVILMLSMLVLPISIACRFSY
FT                   KMVRIMMISVLLNILCSFSGIILAYAVDFPAGPTIAILMGGVYTASLFVKRLLSKSTPS
FT                   PVSPDTNTNVSEGKSF"
     MISFFNHILP SLLLPSLLAA LGASIAGGVV GTYIVVKRIV SISGSISHSI LGGIGLTLWI        60
     QYRLNIEFPP MYGAIIGAII LALCIGKIHL KYQEREDALI AMIWSVGMAI GIIFISQLPA       120
     FNSELVNFLF GNILWVTTSD LFRLGILDVI VLTMVALCHT RFLSLCFDEK YMMLSRYSVQ       180
     TWYFLLVILA AITIVMLIYI MGVILMLSML VLPISIACRF SYKMVRIMMI SVLLNILCSF       240
     SGIILAYAVD FPAGPTIAIL MGGVYTASLF VKRLLSKSTP SPVSPDTNTN VSEGKSF          297
//

If you have problems or comments...

PBIL Back to PBIL home page