(data stored in SCRATCH zone)

EMBL: CR848038.PE197

CR848038.PE197       Location/Qualifiers
FT   CDS             complement(214295..215131)
FT                   /transl_table=11
FT                   /locus_tag="CAB197"
FT                   /product="putative transport poprotein"
FT                   /note="Similar to Chlamydia pneumoniae putative periplasmic
FT                   metal-binding protein precursor cpn0541 or cp0211 or
FT                   cpj0541 SWALL:Y541_CHLPN (SWALL:Q9Z811) (278 aa) fasta
FT                   scores: E(): 1.4e-67, 58.27% id in 278 aa, and to Bacillus
FT                   subtilis manganese-binding lipoprotein MntA precursor
FT                   SWALL:MNTA_BACSU (SWALL:O34385) (306 aa) fasta scores: E():
FT                   1.6e-05, 26.69% id in 206 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB197"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63655"
FT                   /db_xref="GOA:Q5L6R6"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6R6"
FT                   /protein_id="CAH63655.1"
FT                   /translation="MYRIFLFLLFFFSCSPIFGDSKSEEKHVLVSIAPYKFLVEQITGN
FT                   TCKVCSIVTNNYDPHTYELSPRHMEKIVRAQLWFRMGENFEKSCEKNISCPQVDLTKNI
FT                   EIISGHTGCTHRFHSFDTHTWLSPKNLKIQVLAITEALCLHFPEHTALYQSNGAKLLET
FT                   LENLDVEIQEITAAAKQRHILVAHGAFAYFCRDYNFFQHVIEKSNHMEPSPKDIVRAAQ
FT                   SIRKHGISSMILLRHAGKRSSAMLAERFHMATVNLDPYEENVINNLKTIATTFANL"
     MYRIFLFLLF FFSCSPIFGD SKSEEKHVLV SIAPYKFLVE QITGNTCKVC SIVTNNYDPH        60
     TYELSPRHME KIVRAQLWFR MGENFEKSCE KNISCPQVDL TKNIEIISGH TGCTHRFHSF       120
     DTHTWLSPKN LKIQVLAITE ALCLHFPEHT ALYQSNGAKL LETLENLDVE IQEITAAAKQ       180
     RHILVAHGAF AYFCRDYNFF QHVIEKSNHM EPSPKDIVRA AQSIRKHGIS SMILLRHAGK       240
     RSSAMLAERF HMATVNLDPY EENVINNLKT IATTFANL                               278
//

If you have problems or comments...

PBIL Back to PBIL home page