(data stored in SCRATCH zone)

EMBL: CR848038.PE217

CR848038.PE217       Location/Qualifiers
FT   CDS             complement(239539..239880)
FT                   /transl_table=11
FT                   /locus_tag="CAB218"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Chlamydophila caviae hypothetical protein
FT                   cca00222 SWALL:Q824D0 (EMBL:AE016994) (123 aa) fasta
FT                   scores: E(): 6.5e-19, 45.45% id in 110 aa. Note the
FT                   differing N-termini. Also weakly similar to Chlamydia
FT                   pneumoniae hypothetical protein cpn0523 cpn0523 or cpj0523
FT                   or cp0230 SWALL:Q9Z829 (EMBL:AE001637) (110 aa) fasta
FT                   scores: E(): 0.021, 29.88% id in 87 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB218"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63675"
FT                   /db_xref="GOA:Q5L6P6"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6P6"
FT                   /protein_id="CAH63675.1"
FT                   /translation="MLISATTAQSSTCQEPLNLFSKGSVRRSQLTHVVVHCIMQVIILI
FT                   MLITGITVVGCCVHPLFFVFLLAITPVYVSLRLLGGVKLRELFITLRVYPAENQLLNIT
FT                   MLQSKKEEE"
     MLISATTAQS STCQEPLNLF SKGSVRRSQL THVVVHCIMQ VIILIMLITG ITVVGCCVHP        60
     LFFVFLLAIT PVYVSLRLLG GVKLRELFIT LRVYPAENQL LNITMLQSKK EEE              113
//

If you have problems or comments...

PBIL Back to PBIL home page