(data stored in SCRATCH zone)

EMBL: CR848038.PE228

CR848038.PE228       Location/Qualifiers
FT   CDS             complement(250046..251170)
FT                   /transl_table=11
FT                   /locus_tag="CAB230"
FT                   /product="putative exported protein"
FT                   /note="Similar to several proteins of undefined function
FT                   including: Chlamydia pneumoniae CBS domain protein tlyc_2
FT                   or cpn0510 or cp0244 SWALL:Q9Z842 (EMBL:AE001636) (387 aa)
FT                   fasta scores: E(): 4.2e-81, 61.24% id in 387 aa and to
FT                   Chlamydia muridarum hemolysin, putative tc0706 SWALL:Q9PJX0
FT                   (EMBL:AE002339) (374 aa) fasta scores: E(): 6.5e-68, 53.74%
FT                   id in 374 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB230"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63686"
FT                   /db_xref="GOA:Q5L6N5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6N5"
FT                   /protein_id="CAH63686.1"
FT                   /translation="MLYSLLAITLLFLLFSTALSQKTNTSQENTDTPQREPKQSHTPAL
FT                   LAAVLLSFYGILGVALYSQYTWKTKSLSLVFWATYILAAPLAYGCLPYCIKLHKGTHSA
FT                   LCFISSLLQAFFLPLQRYMHRRDEQSKTGNSEMENQLSEAVSSFDKLIVREIMIPKVDI
FT                   FAIQEDTPIRNAFPAIIEEGYSRIPLYKKNIDNITGVLLVKDLLAIYPKSVNSSLPVSS
FT                   VAKPPLYAPEIKKVSSLLQEFRQKHRHLAIIVNEYGITEGIVSMEDIIEEIFGEIADEY
FT                   DVQEDIPYKKVGNSWIVDGRMNISDAEEYFNLKIHHENSYDTLGGHVFHKVGAVPQKGM
FT                   KIHHENFDIEIITCSERSVGKLKITPRKKKLSPS"
     MLYSLLAITL LFLLFSTALS QKTNTSQENT DTPQREPKQS HTPALLAAVL LSFYGILGVA        60
     LYSQYTWKTK SLSLVFWATY ILAAPLAYGC LPYCIKLHKG THSALCFISS LLQAFFLPLQ       120
     RYMHRRDEQS KTGNSEMENQ LSEAVSSFDK LIVREIMIPK VDIFAIQEDT PIRNAFPAII       180
     EEGYSRIPLY KKNIDNITGV LLVKDLLAIY PKSVNSSLPV SSVAKPPLYA PEIKKVSSLL       240
     QEFRQKHRHL AIIVNEYGIT EGIVSMEDII EEIFGEIADE YDVQEDIPYK KVGNSWIVDG       300
     RMNISDAEEY FNLKIHHENS YDTLGGHVFH KVGAVPQKGM KIHHENFDIE IITCSERSVG       360
     KLKITPRKKK LSPS                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page