(data stored in SCRATCH zone)

EMBL: CR848038.PE233

CR848038.PE233       Location/Qualifiers
FT   CDS             complement(252971..253543)
FT                   /transl_table=11
FT                   /locus_tag="CAB235"
FT                   /product="putative 3-methyladenine DNA glycosylase"
FT                   /note="Similar to Prokaryotic and Eukaryotic glycosylases
FT                   including: Chlamydia pneumoniae putative 3-methyladenine
FT                   DNA glycosylase cpn0505 or cp0248 or cpj0505
FT                   SWALL:3MGH_CHLPN (SWALL:Q9Z847) (196 aa) fasta scores: E():
FT                   5.4e-55, 69.35% id in 186 aa and to Rattus norvegicus
FT                   DNA-3-methyladenine glycosylase mpG SWALL:3MG_RAT
FT                   (SWALL:P23571) (317 aa) fasta scores: E(): 4.6e-14, 34.51%
FT                   id in 197 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB235"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63691"
FT                   /db_xref="GOA:Q5L6N0"
FT                   /db_xref="InterPro:IPR003180"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036995"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L6N0"
FT                   /protein_id="CAH63691.1"
FT                   /translation="MLPESFFLNDDVLYLAKELLGHVLVTHLEGQRTSGIIIETEAYRG
FT                   PEDKACHAYNYRKTQRNLPMYSRGGIAYIYRCYGMHSLFNVVTGHQDLPHAVLIRAILP
FT                   YEGEDIMVLRRQWQNKPKHLLTNGPGKVCQALNLTLEYNTHSLSSPQIHISKKKFSGTI
FT                   TQKPRIGIDYAQEYRDLPWRFLLHIKN"
     MLPESFFLND DVLYLAKELL GHVLVTHLEG QRTSGIIIET EAYRGPEDKA CHAYNYRKTQ        60
     RNLPMYSRGG IAYIYRCYGM HSLFNVVTGH QDLPHAVLIR AILPYEGEDI MVLRRQWQNK       120
     PKHLLTNGPG KVCQALNLTL EYNTHSLSSP QIHISKKKFS GTITQKPRIG IDYAQEYRDL       180
     PWRFLLHIKN                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page