(data stored in SCRATCH zone)

EMBL: CR848038.PE234

CR848038.PE234       Location/Qualifiers
FT   CDS             complement(253543..255591)
FT                   /transl_table=11
FT                   /locus_tag="CAB236"
FT                   /product="putative ribonuclease"
FT                   /note="Weakly similar to Escherichia coli ribonuclease R
FT                   Rnr or VacB or b4179 SWALL:RNR_ECOLI (SWALL:P21499) (813
FT                   aa) fasta scores: E(): 2.3e-41, 28.95% id in 701 aa and to
FT                   Chlamydia muridarum ribonuclease R Rnr or VacB or tc0676
FT                   SWALL:RNR_CHLMU (SWALL:Q9PK00) (692 aa) fasta scores: E():
FT                   5.7e-195, 71.64% id in 677 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB236"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63692"
FT                   /db_xref="GOA:Q5L6M9"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6M9"
FT                   /protein_id="CAH63692.1"
FT                   /translation="MVKRIRKKRPQSFRRNSKQIFISGVLFVHAKKGFGFVTPDHPEEY
FT                   PFDIFIPARDLKGALDGDHVVVSLFPNSKEGEKRKGGIHQVISRGKTVLVGTITSLTDT
FT                   STAFVCVNALGPEIPVKAKLIPKRTYKIGDRLLLSTPVWNAKPESKEPPPLEMLEFIGN
FT                   ISNAKSDFPCIKAEYGINEEFPEAVIEETHHFSQKHISQALRSRKDLRDLLCFTIDSIT
FT                   AKDFDDAVSLTYDNNDNYILGVHIADVSHYVTPHSALDQEASKRCNSIYFPGKVIPMLP
FT                   PALSDNLCSLKPNVDRLAVSVFMTFTKSGHLSDYEIFRSVIRSKYRMTYDEVDEIVENK
FT                   QPHPIAKTLLAMAELSEKFSDIREQRGCIRLVLPLFTMSLDNLQEPVTLIETRQTLSHK
FT                   LIEEFMLKANEVVAYHISHQGVSLPFRIHESPNDESLLSFQEIAKAMGFDIIMTPAQEP
FT                   DFQYLLQESSAGHPLEPILHSQFVRSMKTASYSTENKGHYGLKLDFYTHFTSPIRRYID
FT                   LIVHRLLFHPMSIEETRLEHIVRACSTQERIAAKAEFAFENLKKNRFLHKFLKEQPDTI
FT                   YQGYIITITPEGLSFTVPEFCQEGFIPSAQLPKEFSLKKKTSPNDLPPKMRPGAPIQVK
FT                   LSEVNLLNQVITWSLVTKTPNTVKKQPTSTKKTQNKKPRTRRKRNTE"
     MVKRIRKKRP QSFRRNSKQI FISGVLFVHA KKGFGFVTPD HPEEYPFDIF IPARDLKGAL        60
     DGDHVVVSLF PNSKEGEKRK GGIHQVISRG KTVLVGTITS LTDTSTAFVC VNALGPEIPV       120
     KAKLIPKRTY KIGDRLLLST PVWNAKPESK EPPPLEMLEF IGNISNAKSD FPCIKAEYGI       180
     NEEFPEAVIE ETHHFSQKHI SQALRSRKDL RDLLCFTIDS ITAKDFDDAV SLTYDNNDNY       240
     ILGVHIADVS HYVTPHSALD QEASKRCNSI YFPGKVIPML PPALSDNLCS LKPNVDRLAV       300
     SVFMTFTKSG HLSDYEIFRS VIRSKYRMTY DEVDEIVENK QPHPIAKTLL AMAELSEKFS       360
     DIREQRGCIR LVLPLFTMSL DNLQEPVTLI ETRQTLSHKL IEEFMLKANE VVAYHISHQG       420
     VSLPFRIHES PNDESLLSFQ EIAKAMGFDI IMTPAQEPDF QYLLQESSAG HPLEPILHSQ       480
     FVRSMKTASY STENKGHYGL KLDFYTHFTS PIRRYIDLIV HRLLFHPMSI EETRLEHIVR       540
     ACSTQERIAA KAEFAFENLK KNRFLHKFLK EQPDTIYQGY IITITPEGLS FTVPEFCQEG       600
     FIPSAQLPKE FSLKKKTSPN DLPPKMRPGA PIQVKLSEVN LLNQVITWSL VTKTPNTVKK       660
     QPTSTKKTQN KKPRTRRKRN TE                                                682
//

If you have problems or comments...

PBIL Back to PBIL home page