(data stored in SCRATCH zone)

EMBL: CR848038.PE241

CR848038.PE241       Location/Qualifiers
FT   CDS             263842..264132
FT                   /transl_table=11
FT                   /locus_tag="CAB243"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to several proteins of unknown function e.g.
FT                   Chlamydia trachomatis hypothetical protein Ct388
FT                   SWALL:O84393 (EMBL:AE001312) (115 aa) fasta scores: E():
FT                   5.3e-17, 52.08% id in 96 aa and Pasteurella multocida
FT                   hypothetical protein Pm1313 SWALL:Q9CLC6 (EMBL:AE006170)
FT                   (99 aa) fasta scores: E(): 3.7e-05, 35.52% id in 76 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB243"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63699"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L6M2"
FT                   /protein_id="CAH63699.1"
FT                   /translation="MHQEYWILEVKVTPKSKQNTIVGFEGEVLKIRVTEVPEKGKANEA
FT                   VIALLAKALSLPKRDITLIPGDTSRKKRILLPKSTESIVSHWREKGFYAGL"
     MHQEYWILEV KVTPKSKQNT IVGFEGEVLK IRVTEVPEKG KANEAVIALL AKALSLPKRD        60
     ITLIPGDTSR KKRILLPKST ESIVSHWREK GFYAGL                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page